KEGG   Mesorhizobium ciceri: Mesci_1465Help
Entry
Mesci_1465        CDS       T01401                                 

Definition
(RefSeq) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00020  Citrate cycle (TCA cycle)
mci00620  Pyruvate metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_1465
   00020 Citrate cycle (TCA cycle)
    Mesci_1465
   00620 Pyruvate metabolism
    Mesci_1465
Enzymes [BR:mci01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mesci_1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 10116915
NCBI-ProteinID: YP_004140674
UniProt: E8T8G8
Position
1521311..1522705
Genome map
AA seq 464 aa AA seqDB search
MPTEVILPKVDMDMATGQISRWFAEEGAHVKKGDVLFEIETDKAAMEIDAPASGVLRDVT
GKEGVDIAVGAAVAWIYADGEAYGADAAAAKQDVAPISTPAGEMSTKSTEGGAVAPTSHS
VTHPSALPSLPPLGISPTRGEIGQSPSAGRATPLARRLAREAGLNLSTVSGTGPHGRVVK
ADVDAAIAGGGAQAAPAAKAPAGVPAAAPAAPVKAMSDDQVLKLFEQGSYDLVPHDNMRK
TIARRLVEAKTTIPHFYLTLDCELDALLALRTQINAAAPVKKTDKGDAPAYKLSVNDMVI
KAMAMALKAVPDANASWTESAMVKHKHADVGVAVSIPGGLITPIIRKADEKTLSTISNEM
KDLASRARSRKLKPEEYQGGTTAVSNLGMFGIKDFAAVINPPHATILAVGAGEERAVVKN
GEIRIATMMSVTLSTDHRAVDGALGAELLVAFKNLLENPMGLLV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgaagtcattcttcccaaggtcgacatggacatggcgaccggacagatctcg
cgctggtttgccgaggagggcgcgcacgtcaagaagggcgatgtgctgttcgagatcgag
accgacaaggcggcgatggaaatcgatgcgccggccagcggcgtcctgcgcgatgtcacc
ggcaaagagggtgtcgatattgcggtcggcgctgccgtggcgtggatctatgccgacggt
gaggcctatggggctgatgctgctgcggcaaagcaggacgtcgcgccaatctccacaccc
gcgggggagatgtcgacgaagtcgacagaggggggcgctgtcgcgccaacgtctcattct
gtcactcacccctctgccctgccctctttgccgccacttggcatctcccccacaaggggg
gagatcggccaatcgccatcggccggccgtgcaacaccgcttgcccggcgcctggcccgt
gaggccggcctgaacctctcgaccgtatctggcaccggtccgcatggccgggtggtgaag
gcggatgtcgacgcggcgattgccggtggcggcgcccaggcggcgcctgccgccaaggct
ccggctggcgtgccggctgctgctcctgccgcgccggtaaaggcgatgtcggacgatcag
gtcctgaaactgttcgaacagggctcctatgacctcgtcccgcatgacaatatgcgcaag
accattgcgcgccgcctggtcgaggccaagaccaccattccgcatttctacctgacgctc
gactgcgagctcgatgcgctgctggcgctgcgcacgcagatcaatgcggcagccccggtg
aagaagaccgacaagggtgatgctccggcctacaagctgtcggtcaacgatatggtcatc
aaggcgatggcgatggcgctgaaggcagtgcccgatgccaatgcctcgtggactgaaagc
gccatggtcaagcacaagcacgccgatgtcggcgttgccgtgtcgatccccggcgggctg
atcacaccgatcatccgcaaagccgacgaaaagacgctgtccaccatctccaacgagatg
aaggatctggccagtcgcgcgcgcagccgcaagctgaagccggaagagtatcagggtggc
accacggcggtgtccaatctcggcatgttcggcatcaaggattttgccgcggtcatcaac
ccgccgcacgcgaccatcctggcggtcggcgccggcgaggagcgggcggtggtcaagaat
ggcgagatcagaatagccaccatgatgtcggtgacgctgtcgaccgaccaccgcgccgtc
gacggtgcgctgggtgccgaactgctggtcgccttcaagaacctccttgaaaatccgatg
ggcctgctggtctga

DBGET integrated database retrieval system