KEGG   Mesorhizobium ciceri: Mesci_1753Help
Entry
Mesci_1753        CDS       T01401                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mci  Mesorhizobium ciceri
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mesci_1753
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mesci_1753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1827128..1828033)
Genome map
AA seq 301 aa AA seqDB search
MIIVIGSINLDLIAKVDRLPSPGETVGGSAFTTAPGGKGANQALAAARAGASVRMVGAVG
RDSFAAEALALLRDGKVDLSGVAETHASTGTALIMVADDGENIIAVVPGANASVVPGDLS
KAFLKKGDVVLLQNEIPLATVDAALDQARAAGAITVLNTAPFQGQAAGFIGKADYVVANE
TEFDLYGEALSLQGRDRAARMRDFAGKTGRTVVVTLGGDGVMAATPSEFLTVPARKITPV
DTVGAGDTFCGYFAASLSSGLTLEQALARAGAAGSLACLKPGAQPAIPLAKDVDQALQET
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
ttgattatcgtcatcggctcgatcaacctcgaccttatcgccaaggtcgaccgcttgccg
agccccggcgagacggtgggcggctcggccttcaccaccgcgcctgggggcaagggcgcc
aaccaggcactggccgccgcacgcgccggtgcctcggtgcgcatggtcggcgccgtcggc
agggacagcttcgcagccgaggcactggcattgctgcgcgacggcaaggtcgacctgtcc
ggcgttgccgagactcacgcctcgaccggcacggcactgatcatggtcgccgacgacggc
gaaaacatcatcgccgtggtgccgggcgccaacgcttccgtggtgccaggcgatctctcc
aaggcctttctgaaaaaaggcgacgtcgtgctgctgcaaaatgagattccgctggccacc
gtcgatgccgccctcgaccaggcaagggcggccggcgccatcaccgtgctcaacacggcg
ccttttcaggggcaagcagccggctttatcggcaaggccgactatgtcgtcgccaacgaa
accgagttcgacctctatggcgaagcgctgtcgctgcaaggccgcgaccgggcggcccgc
atgcgcgactttgccggaaagaccggccgcaccgtcgtcgtcacgcttggcggcgacggc
gtgatggcggcgacaccgagcgaattcctcaccgttccggcacgcaagatcacccctgtc
gacacggtcggcgccggcgatacgttctgcggctatttcgccgccagcctgtcgtcgggc
ctcacgctcgaacaggcgctggcgcgcgccggcgcggccggttcgctggcctgcctgaag
cctggagcccaaccggcgatcccgctcgccaaagacgtcgatcaggcgctgcaggaaacc
cgttaa

DBGET integrated database retrieval system