KEGG   Mesorhizobium ciceri: Mesci_1874Help
Entry
Mesci_1874        CDS       T01401                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mesci_1874
Enzymes [BR:mci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mesci_1874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1950854..1951831)
Genome map
AA seq 325 aa AA seqDB search
MTDLFTENSLFHEIEGNPRPENATGGFFTTRDRKNIRYGLFGAVARPMKGTVVLLTGRNE
CIEKYFETIRNLADRGFGVATLDWRGQGDSDRLIRDRQRGYVSSFRDYTADLEQFFEEIV
LPDCRGPYYILAHSAGALITLLAAPSMVNRVRRMVLIAPFLTLPDLPVSISTVRRVCSLF
CALGLGRLYAAWGPRPRVTAPFETNKLTSDPERYRRNTRIYEEYPQLALGGPTIRWLRAA
AKASEAVSDPDFMARIQVPLLIIAAGADQVVSTRAVEAYARRLRLGSLLMIDGSRHEILQ
EADIYREQLLAAFDAFIPGSDDPTA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgacggatcttttcaccgaaaactccctttttcacgaaatcgagggcaatccgcggccg
gaaaacgccaccggcggcttcttcaccacgcgtgaccgcaagaatatccgctacggcctg
ttcggcgcggtcgctcgcccgatgaagggcaccgtggtcctgctcaccggccgcaacgag
tgcatcgagaaatatttcgaaaccatccgcaaccttgccgatcgtggctttggcgtcgcc
acgctcgactggcgcggccagggcgattcagaccggctgattcgcgatcgccagcgcggc
tacgtcagcagcttccgcgactacaccgccgacctcgaacagttcttcgaggagatcgtg
ctgcccgattgccgcggaccctactacatcctggcccattcggcaggcgcattgatcacc
ctgctggccgcgccgtcgatggtgaaccgcgttcggcgcatggtgctgatcgcgcctttc
ctgacgctgcccgacctgccggtctcgatctcgacggttcgccgcgtctgttccctgttc
tgcgctctcggcctcggccggctctatgccgcctggggtccgcggccgagggtaacggcc
cctttcgagaccaacaagctgacatcggacccggaacgctatcggcgcaacacacggatc
tatgaagaatacccgcaactggcgcttggcgggccgacgatccgttggctgcgggcagcc
gcgaaagcttcggaagccgtcagcgaccccgacttcatggcccggatccaggtcccgctg
ctgatcatcgccgccggcgccgaccaggtcgtctcgaccagggctgtcgaagcctacgcc
aggcgtctgcggctcggttcattgctgatgatcgacggctcccgccacgaaatcctgcag
gaagccgatatctaccgcgagcaattgctcgccgccttcgacgccttcattcccggcagc
gacgaccccacggcctga

DBGET integrated database retrieval system