KEGG   Mesorhizobium ciceri: Mesci_1881Help
Entry
Mesci_1881        CDS       T01401                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mci  Mesorhizobium ciceri
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mesci_1881
   00052 Galactose metabolism
    Mesci_1881
   00500 Starch and sucrose metabolism
    Mesci_1881
   00520 Amino sugar and nucleotide sugar metabolism
    Mesci_1881
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mesci_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1963526..1964431
Genome map
AA seq 301 aa AA seqDB search
MKRVRKAVFPVAGLGTRFLPATKAVPKEMLTVVDRPVIQYVVDEAREAGIEHFIFVTGRN
KAVIEDHFDIQFELYDTLAQRGKDDQLARLQRLQPAPGQTSFTRQQVPMGLGHAVWCARE
LVGDEPFALLLPDMIMQSEKSCTKAMVELYEETGNNIIAVQECDPAETHKYGIVGRGEDT
HHGFRITEMVEKPKAGTAPSNLYINGRYILQPEIFKILEGQEKGAGNEIQLTDAMLKLEK
QQPFYGYHYRGRTFDCGSPEGFVEANVAFALWRSDMNENMAGVIRTLLDELKPSERRGAA
F
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagttcgcaaggcagtcttcccggtcgccggcctcggcacacggtttcttccg
gccaccaaggctgtccccaaggaaatgctgaccgtcgtcgaccggccggtgatccagtat
gtggtggatgaggcgcgcgaggccggcatcgagcatttcatcttcgtcaccggccgcaac
aaggccgtcatcgaggaccatttcgacatccagttcgaactctatgacacgctggcccag
cgcggcaaggacgaccagctcgcccgtctgcagcggctgcagccggcgccggggcagacc
agtttcacacgccagcaggtgccgatgggacttggccacgccgtctggtgcgcccgcgag
ctcgtcggcgacgagcccttcgcgcttttgttgcccgacatgatcatgcagtcggagaag
agctgcacgaaggcaatggtcgagctctacgaggagacgggcaacaacatcatcgcggtg
caggaatgcgatcccgccgaaacccacaaatacggcatcgtcggccgcggcgaggacacg
catcacggcttccgtatcaccgagatggtggaaaagccgaaggccggcaccgcgccgtcc
aacctgtacatcaacggccgctacatcctgcagccggagatcttcaagatcctagaaggt
caggaaaaaggcgccggcaacgagatccagctcaccgacgccatgctgaagctggaaaag
cagcagcctttctacggctaccactatcgaggccgcacgttcgactgcggatcgccggag
ggttttgtcgaggccaatgtcgccttcgcgctgtggcgcagcgacatgaacgagaacatg
gcgggcgtcatccgcacgcttctcgacgagctgaagccgtcagagcgccgtggcgctgcg
ttttaa

DBGET integrated database retrieval system