KEGG   Mesorhizobium ciceri: Mesci_2357Help
Entry
Mesci_2357        CDS       T01401                                 

Definition
(RefSeq) glycoside hydrolase family protein
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00052  Galactose metabolism
mci00561  Glycerolipid metabolism
mci00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mesci_2357
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesci_2357
   00600 Sphingolipid metabolism
    Mesci_2357
Enzymes [BR:mci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mesci_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 10117826
NCBI-ProteinID: YP_004141554
UniProt: E8TL80
Position
2461260..2462726
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFKDIEFALTDVSEHNLQMIKAILDRIVEANRL
PTRVTATTDRRKALEGARYVISCVRVGGLEAYADDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAETNVKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQI
AEVLGAKSTQELDYVCSGINHQTWFIDLRLNGRPIGKDELVAAFEAHPVYSRQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITRWIDMSDWIHGETGGYLRYSTETRNWFETE
YPQFLEAASKPIDREKRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPHDAIIESPG
FVDRFGINMAASITLPEACAATCIASINVQRMSVHAAISGDIDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAQAAWLPQYAHAVPAARERLSTSKVKTREWAGAARRSVRSIEELRAE
KAALKQAG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcaaaatcgctatcatcggtgccggcagcgtcggcttcaccaagaaattgttc
accgacatcctgtgcgtgcccgaattcaaggacatcgaattcgcgctgaccgacgtcagc
gagcacaatcttcagatgatcaaggcgatcctcgacaggatcgtcgaggcgaacaggttg
ccgaccagggtgacggcgaccaccgaccgccgcaaggcgctcgaaggcgctcgctacgtc
atcagctgcgtgcgggtcggcggcctcgaagcctacgccgacgatatccgcattcccttg
aaatacggcatcgaccagtgcgtcggcgatacgatctgtgccggcggcattctctatggc
cagcgcaacattccggtgatcctggatttctgcaaggatatacgcgaggtcgccgagacg
aacgtcaaattcctgaactacgccaacccgatggcgatgaacacctgggcggcgatcgaa
tacggcaaggtcgacactgtcgggctctgtcacggcgtccagcacggcgccgagcagatc
gccgaggtgcttggcgcgaagtccacgcaggagctcgactatgtctgttccggcatcaac
caccagacctggttcatcgatctgcgcctcaacggccgccccattggcaaggatgaactg
gtggccgctttcgaggcgcatccggtctattccaggcaggagaagctgcgcatcgacgtc
ctgaagcgcttcggcgtctattcgaccgaaagcaacggtcatctttccgaatatctgccc
tggtaccgcaaacgtcccgacgagatcacgcgctggatcgatatgtccgactggattcac
ggcgagaccggcggctatctccgctactccaccgaaacccgcaactggttcgagacggaa
tatccgcagttcctcgaagcggcgtccaagccgatcgaccgcgagaaacgctccaacgag
catgccagccacatattggaggcgctggagaccaaccgcgtctatcgcggccacttcaac
gtcaagaacaatggggtgatcaccaacctgccgcacgatgccatcatcgagtcgccgggc
ttcgtcgaccgtttcggcatcaacatggccgccagcatcacgttgccggaggcttgcgcc
gccacctgcatcgcttcgatcaacgtccagcgcatgtcggtgcatgccgcgatatcgggc
gacatcgatcttctgaagctcgccgtgctgcatgacccgttggtcggcgcggtttcgacg
ccggaggaggtttggcagatggtcgacgaaatggtcgtcgcccaggcagcctggctgccg
caatacgcccatgcggttccggccgccagggagcggctgtcgacatccaaggtgaagacc
cgcgagtgggcgggcgccgcacggcgcagcgttcgctcgatcgaggaattgcgcgccgaa
aaagccgcgctgaagcaagccggctga

DBGET integrated database retrieval system