KEGG   Mesorhizobium ciceri: Mesci_2362Help
Entry
Mesci_2362        CDS       T01401                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
mci  Mesorhizobium ciceri
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mesci_2362
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesci_2362
   00600 Sphingolipid metabolism
    Mesci_2362
Enzymes [BR:mci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Mesci_2362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2468915..2470285
Genome map
AA seq 456 aa AA seqDB search
MARNPKITFIGAGSTVFMKNIVGDVLQRPSLSGATIALMDINPQRLEESAIVVNKLIATL
GVKAKTETHSDQRKALAGADFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKVCEDMLAVCPQAIMLQYVNPMAINTWAIAEKYPAIRQVGLCHSVQGTA
MELAEDLDLPYEEIRYRSAGINHMAFYLKFEHRQPDGSYRDLYPDLVRAYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGRPDLIEKYGIPLDEYPKRCIEQ
IERWKGQAEAYRSADRIEVEQSREYASSIMNSVWTGEPSVIYGNVRNNGCITSLPRDCAA
EVPCLVDASGIQPTYIGDLPPQLTALIRTNINVQELTVRALMTENREHIYHAAMMDPHTA
AELDLDQIWSLVDDLLAAHGDWLPGWARVARKTEAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaatcccaagatcacgttcatcggcgccggctcgacggtgttcatgaagaac
attgtcggcgacgtgctgcagcgcccgtcgctgtccggcgcaacgatcgcgctgatggac
atcaatccgcagcggctggaagagagcgccattgtcgtcaacaagctgatcgcgacgctt
ggcgtcaaggcgaagaccgagacccattcggatcagcgcaaggcgctggccggcgcggat
ttcgtcgtcgtcgccttccagatcggcggctacgagccctgcaccgtcactgacttcgag
gtgccgaagaaatacggcctgcgccagacgatcgccgacacgctcggcgtcggcggcatc
atgcggggcttaaggaccgtgccgcatctgtggaaggtgtgcgaagacatgctcgccgtc
tgcccgcaggcgatcatgctgcaatatgtcaacccgatggcgatcaacacctgggcgata
gcagagaaataccctgcgatcaggcaggtcggcctctgccattcggtgcagggcacggca
atggaactggctgaagacctcgaccttccctacgaagagatccgctatcgctcggccggc
atcaaccacatggcgttttatctgaagttcgagcatcgccagccggacggttcctaccgc
gacctctacccagatctcgtgcgcgcctatcgcgaaggccgcgcgcccaagcccggctgg
aacccgcgctgtcccaacaaggtgcgctacgagatgctgaccaggctcggctatttcgtc
accgagagctcggagcactttgccgaatacacgccctatttcatcaaggagggccgcccc
gacctgatcgagaaatacggcatcccgctggatgaatatcccaagcgctgcatcgagcag
atcgagcgctggaagggacaggctgaagcctatcgctcggccgatcgcatcgaggtagag
cagtcccgggaatatgcctcctcgatcatgaattcagtctggaccggcgagccgtcggtg
atctacggcaatgtccgcaacaatggctgcatcacctcgctgccccgcgattgcgccgcc
gaagtgccgtgcctggtcgatgcctccggcatccagccgacctatataggcgacctgccg
ccgcaattgactgcgctgatccgcaccaacatcaacgtgcaggaactgacggtgcgggct
ctgatgaccgagaaccgcgagcacatctaccacgcggcgatgatggatccgcacaccgcg
gccgaactcgatctcgaccagatctggtcactggtcgatgatctcttggccgctcacggc
gactggctgccgggctgggcgcgggtggcgcgcaagaccgaggccgcctga

DBGET integrated database retrieval system