KEGG   Mesorhizobium ciceri: Mesci_3201Help
Entry
Mesci_3201        CDS       T01401                                 

Definition
FAD linked oxidase
Orthology
K00102  
D-lactate dehydrogenase (cytochrome) [EC:1.1.2.4]
Organism
mci  Mesorhizobium ciceri
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mci00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3343770..3345182
Genome map
AA seq 470 aa AA seqDB search
MALSDLNPVERNEEGIAAVLGILKQQLGERFQTGQAIRSQHAHTTTYIPTQAPDGVAFPE
TTAEVQEIVRACAAHRVPVIAFGVGSSLEGHTNAPGGGISVDTSRMNRILAVNPQDLDCT
VEPGVTREDLNRHLRDTGLFFPIDPGANASLGGMAATRASGTNAVRYGTMRENVLSLTAV
MADGETVTTGKRAKKSSAGYDLTRLLVGSEGTLGIITSLTLKLQGIPQAISGGVCPFPSV
EAACNAVIATIQMGIPVARIELVNALQMRAMKNYSKLDYPESPCLFVEFHGSDAGVAEQA
ETFGMIAEENGGGPFLWTSVAEERTKLWKARHDAYWSSLTLRPGAKGLSTDVCVPISRFA
ECVMETEADIAEMGLIAPIVGHAGDGNFHVLVLMDVNDPKEIALSEKFVARLNMRAIAMD
GTCTGEHGIGQGKIGFLRHELGHGVDIMRTIKQALDPLDIMNPGKILPGN
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctctgagcgacctcaacccggtcgaacgcaacgaggaaggcatcgccgcggtgctc
ggcatcctcaagcagcagctcggcgagcgattccagaccggccaggcgatccgctcgcag
catgcacataccaccacctacattccgacgcaggcaccggatggcgttgcgttccccgag
acgacggccgaggtgcaggagatcgtgcgcgcctgtgcggcgcaccgcgtgccggtgatc
gccttcggcgtcggttcctcgctggagggtcacaccaacgcacccggcggcggcatatcg
gtcgacacctcgcgcatgaaccgcatcctggccgtcaatccgcaggatctcgactgcacg
gtcgaacccggcgtcacccgcgaggatttgaaccggcatctgcgcgacaccggcctgttc
tttccgatcgatcccggtgccaatgcctcgctgggcggcatggccgcaacgcgggcctcc
ggcaccaacgcggtgcgctacggcacgatgcgcgagaacgtgctgtcgctgaccgccgtc
atggccgacggcgaaacggtgacgaccggcaagcgggcgaaaaagagctcggccggctat
gatctgacgcggctgctggtcggctcggaaggcacgctcggcatcatcacgtcgctgacc
ttgaagctgcaaggcatcccgcaggcgatttcgggcggcgtctgcccgtttccgagcgtc
gaggcggcctgcaacgcggtcatcgcgacgatccagatgggcatcccggtggcgcgcatc
gaactggtcaacgccttgcagatgcgggcgatgaagaattattccaagctcgactatccc
gaaagcccgtgcctgttcgtcgagttccatggcagcgatgccggtgttgccgaacaggcc
gagaccttcggcatgatcgcggaggagaatggcggcgggccgttcctgtggaccagcgtc
gccgaggagcgcaccaaactgtggaaggcgaggcacgacgcctactggtcgtcgctgacc
ctgcggcccggcgccaaggggctgtcgaccgatgtctgcgtgccgatctcgcgctttgcc
gaatgcgtcatggaaaccgaggccgatatcgccgagatgggcctgatcgcgccgatcgtc
ggccatgccggcgacggcaatttccacgtgctggtgctgatggatgtgaacgatcccaag
gagatcgcgctgtcggaaaagttcgtcgcgcggctcaacatgcgagccatcgccatggac
ggcacctgcaccggcgagcacggcatcggccagggcaagatcggcttcctgcgccacgag
ctcggccacggcgtcgacatcatgcgcaccatcaagcaggcgctcgatccgcttgatatc
atgaacccgggcaagatcttgccgggaaactaa

DBGET integrated database retrieval system