KEGG   Mesorhizobium ciceri: Mesci_3223Help
Entry
Mesci_3223        CDS       T01401                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mci  Mesorhizobium ciceri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesci_3223
   00670 One carbon pool by folate
    Mesci_3223
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mesci_3223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3366597..3367115
Genome map
AA seq 172 aa AA seqDB search
MHVAIYVAIAENGVIGRDGGLPWRLSTDLKRFKADTMGKPIIMGRKTYEGIGRPLPGRLN
IVVTRDETWRAEGVEVAHSLEAAIQLATVRGRGMADVDEVCVIGGGEIYAQAMLLADRLH
VTHVLAAVDGDAHFPPIDPDSWRIVSSQDVPAGEKDSHPTRYSVYERRRERH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcgcaatctacgttgccattgccgagaacggcgtgatcgggcgggacggcggg
ctcccgtggcggctctccaccgatctcaagcgcttcaaggccgatacgatgggcaagcct
atcatcatgggccgcaagacctatgagggcatcggtcggccgctgccgggcaggttgaac
atcgtcgtgacccgcgacgagacctggcgcgccgagggcgtcgaggtggcacattcgctc
gaagccgcgatccagctggcgacggtgcgcgggcgcggcatggccgatgtcgacgaggtg
tgcgtcatcggcggcggcgaaatctatgcccaggccatgctgctggccgaccggctgcac
gtcacccatgtgctggcagcggtcgacggcgacgcgcatttcccgccgatcgatcccgat
tcctggcgcattgtcagctcgcaggacgtcccagccggggaaaaggacagccacccgacg
cgctattcggtttacgagcggcgtcgcgagagacattga

DBGET integrated database retrieval system