KEGG   Mesorhizobium ciceri: Mesci_3223Help
Entry
Mesci_3223        CDS       T01401                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mci  Mesorhizobium ciceri
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mci00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mci00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3366597..3367115
Genome map
AA seq 172 aa AA seqDB search
MHVAIYVAIAENGVIGRDGGLPWRLSTDLKRFKADTMGKPIIMGRKTYEGIGRPLPGRLN
IVVTRDETWRAEGVEVAHSLEAAIQLATVRGRGMADVDEVCVIGGGEIYAQAMLLADRLH
VTHVLAAVDGDAHFPPIDPDSWRIVSSQDVPAGEKDSHPTRYSVYERRRERH
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtcgcaatctacgttgccattgccgagaacggcgtgatcgggcgggacggcggg
ctcccgtggcggctctccaccgatctcaagcgcttcaaggccgatacgatgggcaagcct
atcatcatgggccgcaagacctatgagggcatcggtcggccgctgccgggcaggttgaac
atcgtcgtgacccgcgacgagacctggcgcgccgagggcgtcgaggtggcacattcgctc
gaagccgcgatccagctggcgacggtgcgcgggcgcggcatggccgatgtcgacgaggtg
tgcgtcatcggcggcggcgaaatctatgcccaggccatgctgctggccgaccggctgcac
gtcacccatgtgctggcagcggtcgacggcgacgcgcatttcccgccgatcgatcccgat
tcctggcgcattgtcagctcgcaggacgtcccagccggggaaaaggacagccacccgacg
cgctattcggtttacgagcggcgtcgcgagagacattga

DBGET integrated database retrieval system