KEGG   Mesorhizobium ciceri: Mesci_3426Help
Entry
Mesci_3426        CDS       T01401                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mci00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mci00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3579958..3580980
Genome map
AA seq 340 aa AA seqDB search
MAMKDGEVFGTTQAGEQVRRFTIRGGGITANIIGLGAIIQDLRLTGHDAPLVLGYDSLEG
YETDTAFFGAVVGRYANRIRDGRFTIGGSRYQTEQNFLDKHTLHGGSQGYSHRPWTVSLH
GRDFVTLTLHDPDGTMGFPGALDVTCTYRLKIPGTLSVELTATCEEPTLCNLTQHSYFNL
DDGGAGDILDHRMMLNAGAYLPVDGDMIPTGVVKPVDGTPFDFRQARPLRMETEGDQLPY
DQNFCLASARGPLKQAAWTQGASSGVEMEVWTTEPGVQLYTGQYVTPRTGLEGRNYKAYC
GFCLEPQIWPDAPNRPYFPQATLWPGAIYHHVTEYRFRLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggacggcgaggttttcggcacgacgcaggctggcgagcaggtgcgtcgc
ttcacgatcaggggcggcggcatcacagccaacatcatcggtctgggcgcgatcatccag
gatttgcgcctgaccgggcacgatgctccgctggtgctcggctacgacagtctggaaggc
tacgagacggatacggccttcttcggtgcggtcgtcggccgctatgccaaccgcatccgc
gacggccgcttcaccattggcggcagccgctaccagaccgagcaaaacttcctcgacaag
catacgctgcatggcggctcgcaaggttactcccaccggccgtggacggtttccttgcat
ggcagggatttcgtcacgctgacgctgcacgatcccgacggcacgatgggttttcccggc
gcgctcgacgtcacctgcacctaccggctgaagatccccggcacgctcagcgtcgagctg
accgccacctgcgaggagccgacgctgtgcaatctcacccagcattcctatttcaacctt
gatgatggcggcgcaggcgacattctcgaccacaggatgatgctgaatgccggcgcctac
ctgccggtcgatggcgacatgatccccacaggcgtggtcaagccggttgacggcacgcca
ttcgatttccgccaggcgcggccgctgcgcatggaaaccgagggtgatcaactgccctac
gaccagaatttctgccttgcttcggcacgcgggccgctcaagcaggcggcatggacgcaa
ggcgccagttccggtgtcgagatggaggtctggaccaccgagcccggcgtccagctctat
accggccagtatgtgacgccgcgcaccgggctggaagggcggaactacaaggcctattgc
ggcttctgcctggagccgcagatttggccggacgcgccgaaccggccttatttcccgcaa
gcaacgctgtggccgggcgcgatctaccaccacgtcacggaatacaggttccgcctgccc
tag

DBGET integrated database retrieval system