KEGG   Mesorhizobium ciceri: Mesci_3426Help
Entry
Mesci_3426        CDS       T01401                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00052  Galactose metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_3426
   00052 Galactose metabolism
    Mesci_3426
Enzymes [BR:mci01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Mesci_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 10118905
NCBI-ProteinID: YP_004142599
UniProt: E8TJA9
Position
3579958..3580980
Genome map
AA seq 340 aa AA seqDB search
MAMKDGEVFGTTQAGEQVRRFTIRGGGITANIIGLGAIIQDLRLTGHDAPLVLGYDSLEG
YETDTAFFGAVVGRYANRIRDGRFTIGGSRYQTEQNFLDKHTLHGGSQGYSHRPWTVSLH
GRDFVTLTLHDPDGTMGFPGALDVTCTYRLKIPGTLSVELTATCEEPTLCNLTQHSYFNL
DDGGAGDILDHRMMLNAGAYLPVDGDMIPTGVVKPVDGTPFDFRQARPLRMETEGDQLPY
DQNFCLASARGPLKQAAWTQGASSGVEMEVWTTEPGVQLYTGQYVTPRTGLEGRNYKAYC
GFCLEPQIWPDAPNRPYFPQATLWPGAIYHHVTEYRFRLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaggacggcgaggttttcggcacgacgcaggctggcgagcaggtgcgtcgc
ttcacgatcaggggcggcggcatcacagccaacatcatcggtctgggcgcgatcatccag
gatttgcgcctgaccgggcacgatgctccgctggtgctcggctacgacagtctggaaggc
tacgagacggatacggccttcttcggtgcggtcgtcggccgctatgccaaccgcatccgc
gacggccgcttcaccattggcggcagccgctaccagaccgagcaaaacttcctcgacaag
catacgctgcatggcggctcgcaaggttactcccaccggccgtggacggtttccttgcat
ggcagggatttcgtcacgctgacgctgcacgatcccgacggcacgatgggttttcccggc
gcgctcgacgtcacctgcacctaccggctgaagatccccggcacgctcagcgtcgagctg
accgccacctgcgaggagccgacgctgtgcaatctcacccagcattcctatttcaacctt
gatgatggcggcgcaggcgacattctcgaccacaggatgatgctgaatgccggcgcctac
ctgccggtcgatggcgacatgatccccacaggcgtggtcaagccggttgacggcacgcca
ttcgatttccgccaggcgcggccgctgcgcatggaaaccgagggtgatcaactgccctac
gaccagaatttctgccttgcttcggcacgcgggccgctcaagcaggcggcatggacgcaa
ggcgccagttccggtgtcgagatggaggtctggaccaccgagcccggcgtccagctctat
accggccagtatgtgacgccgcgcaccgggctggaagggcggaactacaaggcctattgc
ggcttctgcctggagccgcagatttggccggacgcgccgaaccggccttatttcccgcaa
gcaacgctgtggccgggcgcgatctaccaccacgtcacggaatacaggttccgcctgccc
tag

DBGET integrated database retrieval system