KEGG   Mesorhizobium ciceri: Mesci_3429Help
Entry
Mesci_3429        CDS       T01401                                 

Definition
Di-heme cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mci  Mesorhizobium ciceri
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3582522..3583721
Genome map
AA seq 399 aa AA seqDB search
MKRLFRFLALMVAVVLVGCGKPDFSDAEKKTIASLALSSLPALKPDTTNHFADVPAAAAL
GSTLFFDQGMSGDGSVSCSTCHKIDRQFQDDLPQAVGVGHTNRRTMPLAGVAHDPWFFWD
GRRDSLWAQALTPLENPLEQAGNRAAYAHYIKARFGERYERIFGPLPDFSGMPLNASPLG
NDAEKAAWNAMSSAQRDAINGVFVNIGKAIAAFERSIAPAPARFDRFALDLATGAEPKGD
AVFSKQEILGLKLFIGKANCVTCHNGPRFTDNSFHNTGVPPVAGLPPDRGRIDAVHQVEA
DPFNCLGAYRDGDVAACGELRFMVKNAPQLIRAYKTPSLRGAATRPPYMHAGQFSSLDEV
VAHYAKAAPSVEGVSEVHPLELSDRERAALVAFLKTLSE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccttttccgctttctggcgctgatggtcgccgtcgtcctcgtgggctgcggc
aagcctgatttttccgacgcagaaaagaagactatcgcttcgctggcgctgtcgtcgctg
ccggcgctcaagcccgacaccaccaatcattttgccgacgtgccggccgccgccgcactc
ggctcgacgctgttcttcgatcagggcatgagcggtgacgggtcggtatcctgttcgacc
tgccacaagatcgaccgccagttccaggacgacctgccgcaggcggtcggcgtcggccac
accaaccggcgcaccatgccgctggccggcgtggcgcacgatccctggttcttctgggat
ggccgtcgcgacagcctgtgggcgcaagcgttgacgccgctcgaaaatccgctggagcag
gcgggaaaccgcgctgcctacgcgcattacatcaaggcgcgcttcggcgagcgctatgag
cgcatttttgggccgctgcccgatttttccggcatgccgttgaatgccagcccacttgga
aacgatgccgagaaagcagcctggaatgccatgagcagcgcgcagcgcgacgccatcaac
ggtgtcttcgtcaatatcggcaaggcgattgccgccttcgaacgctcgatcgcgccagcg
ccagcgcgcttcgaccgctttgcgctggacctcgccaccggtgccgagccgaagggcgat
gctgtcttttccaaacaagaaatccttgggcttaaactgttcatcggcaaggccaattgc
gtgacctgtcacaacggcccgcgcttcaccgacaacagctttcacaacaccggcgtgccg
cctgttgcgggcctgccgccggatcgcggccgcatcgatgccgtgcaccaagtcgaggcc
gacccgttcaactgccttggcgcctatcgggatggcgacgttgccgcctgcggcgaactg
cgcttcatggtcaagaatgcgccacaactcatccgcgcctacaagacgccgtctctgcgc
ggagcggcaacgcgaccgccctatatgcatgccgggcagttttcgtcgctcgacgaggtc
gtggcgcattatgcgaaggccgcgcccagcgtcgaaggggtatcagaggttcacccgttg
gagctttcagaccgagaacgcgctgctctggtggcgttcttgaagacgctttcggagtga

DBGET integrated database retrieval system