KEGG   Mesorhizobium ciceri: Mesci_3500Help
Entry
Mesci_3500        CDS       T01401                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mci  Mesorhizobium ciceri
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3661237..3661896
Genome map
AA seq 219 aa AA seqDB search
MNQGLPIDDREGFAAFLLRLRGRGTVPKALIAAFEATPRRGFLAAQFHQIAWSDRMLPIE
CGEAIEGADMQAAVIAALTIEQGNRVLEIGTGSGYTSAVMSRLAARVITTDRYKTLAEQA
RQRFEALGIGNVIVRHADGSGGLPNEGPFDRIVAWAAFDSLPRFLLDQLSSGGIVIAPIG
PEEGEQVLAKLTKVGSRFEREDIGLVRLQPILRGVAAVI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagggcctcccgatcgacgaccgcgaaggttttgccgcctttctgctgcgtctg
cgcggccgggggactgtgccgaaggcgctgatcgcggccttcgaggcgacgccgcggcgc
ggcttcctggcggcccagttccatcagatcgcctggtcggaccgcatgctgccgatcgaa
tgcggcgaggcgatcgaaggcgccgacatgcaggcggcggtgatcgccgcactcaccatc
gagcagggcaaccgcgtgctcgagatcggcaccggctcgggctacacctcggcggtgatg
tcgcggctggccgctcgggtcatcaccaccgatcgctacaagacgctcgccgagcaggcg
cggcagcgcttcgaggcgctcggcatcggcaatgtgatcgtgcgccacgccgatggttcc
ggcgggctgccgaatgaagggccatttgaccgcatcgtcgcctgggccgccttcgacagc
ctgccgcgtttcctgctcgaccagttgtcgagcggcggtatcgtcatcgctccgatcggc
cccgaagagggcgaacaggtgctggccaagctgaccaaggtcggcagccgcttcgagcgt
gaagacatcggcctcgttcgcctgcagccgatcctgcgcggtgttgccgctgttatctag

DBGET integrated database retrieval system