KEGG   Mesorhizobium ciceri: Mesci_3695Help
Entry
Mesci_3695        CDS       T01401                                 

Definition
(RefSeq) pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00020  Citrate cycle (TCA cycle)
mci00620  Pyruvate metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_3695
   00020 Citrate cycle (TCA cycle)
    Mesci_3695
   00620 Pyruvate metabolism
    Mesci_3695
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Mesci_3695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 10119181
NCBI-ProteinID: YP_004142864
UniProt: E8TMJ2
Position
3843987..3845024
Genome map
AA seq 345 aa AA seqDB search
MATAARKAPAKSKSDGKSGLSAPKPVEFTKDEELAAYRHMLLIRRFEEKAGQLYGMGFIG
GFCHLYIGQEAVVTGMKMALIDGDQMITAYRDHGHMLAMELSPRGVMAELTGRRGGLSRG
KGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRDNNNVSLTYFGDGAANQGQVYE
SFNMASLWKLPVIYIIENNRYAMGTSVSRSSAETNFSHRGASFKIPGIQVDGMDVRAVKA
AGDQATEWCRAGNGPIILEMQTYRYRGHSMSDPAKYRSKEEVQKMRSDHDPIEQVKARLI
EKKWATEDELKTIDKEVRDIVADAAEFAQNDAEPDPSELWTDIVL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccagaaaagcgcctgccaaatccaaatccgacggcaaatcggggctt
tcggcccccaaacctgtcgaattcaccaaggacgaagagcttgccgcttaccggcacatg
ctgctcatccgtcgtttcgaggaaaaggccggccagctctacggcatgggtttcatcggc
ggcttctgccacctctatatcggccaggaagcggtcgtcaccggcatgaagatggcgctg
atcgacggcgatcagatgatcaccgcctatcgcgaccacggccacatgctggcgatggag
ctgtcgccgcgcggcgtcatggccgagctgaccgggcgtcgcggcggcctgtcacggggc
aagggtggctccatgcacatgttctccaaggaaaagcacttttatggcggccacggcatc
gtcggcgcgcaggtgtcgctcggcacgggcttggccttcgccaaccgctaccgcgacaac
aacaatgtctcgctgacctatttcggcgacggtgcggccaaccagggccaggtctatgaa
agcttcaacatggcctcgctgtggaagctgccggtgatctacatcatcgagaacaaccgg
tatgccatgggcacctcggtgtcgcgctcttcggcggaaaccaatttttcgcaccgtggc
gcttcgttcaagattcccggcatccaggtcgacggcatggacgtgcgcgctgtcaaggcc
gccggcgaccaggcgaccgaatggtgccgcgccggcaacgggccgatcattctcgaaatg
cagacctaccgctaccgggggcactcgatgtccgatccggcgaaataccgctcgaaggaa
gaagtgcagaagatgcgctccgaccatgacccgatcgaacaggtcaaggcgcggctcatc
gagaagaagtgggcaaccgaggacgagcttaagaccatcgacaaggaggtccgcgacatc
gtcgctgacgccgccgaatttgcccagaacgatgcagagccggatccgtccgagctctgg
accgatatcgtattgtaa

DBGET integrated database retrieval system