KEGG   Mesorhizobium ciceri: Mesci_3695Help
Entry
Mesci_3695        CDS       T01401                                 

Definition
pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha
Orthology
K00161  
pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_3695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_3695
   00020 Citrate cycle (TCA cycle)
    Mesci_3695
   00620 Pyruvate metabolism
    Mesci_3695
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Mesci_3695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3843987..3845024
Genome map
AA seq 345 aa AA seqDB search
MATAARKAPAKSKSDGKSGLSAPKPVEFTKDEELAAYRHMLLIRRFEEKAGQLYGMGFIG
GFCHLYIGQEAVVTGMKMALIDGDQMITAYRDHGHMLAMELSPRGVMAELTGRRGGLSRG
KGGSMHMFSKEKHFYGGHGIVGAQVSLGTGLAFANRYRDNNNVSLTYFGDGAANQGQVYE
SFNMASLWKLPVIYIIENNRYAMGTSVSRSSAETNFSHRGASFKIPGIQVDGMDVRAVKA
AGDQATEWCRAGNGPIILEMQTYRYRGHSMSDPAKYRSKEEVQKMRSDHDPIEQVKARLI
EKKWATEDELKTIDKEVRDIVADAAEFAQNDAEPDPSELWTDIVL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccgccagaaaagcgcctgccaaatccaaatccgacggcaaatcggggctt
tcggcccccaaacctgtcgaattcaccaaggacgaagagcttgccgcttaccggcacatg
ctgctcatccgtcgtttcgaggaaaaggccggccagctctacggcatgggtttcatcggc
ggcttctgccacctctatatcggccaggaagcggtcgtcaccggcatgaagatggcgctg
atcgacggcgatcagatgatcaccgcctatcgcgaccacggccacatgctggcgatggag
ctgtcgccgcgcggcgtcatggccgagctgaccgggcgtcgcggcggcctgtcacggggc
aagggtggctccatgcacatgttctccaaggaaaagcacttttatggcggccacggcatc
gtcggcgcgcaggtgtcgctcggcacgggcttggccttcgccaaccgctaccgcgacaac
aacaatgtctcgctgacctatttcggcgacggtgcggccaaccagggccaggtctatgaa
agcttcaacatggcctcgctgtggaagctgccggtgatctacatcatcgagaacaaccgg
tatgccatgggcacctcggtgtcgcgctcttcggcggaaaccaatttttcgcaccgtggc
gcttcgttcaagattcccggcatccaggtcgacggcatggacgtgcgcgctgtcaaggcc
gccggcgaccaggcgaccgaatggtgccgcgccggcaacgggccgatcattctcgaaatg
cagacctaccgctaccgggggcactcgatgtccgatccggcgaaataccgctcgaaggaa
gaagtgcagaagatgcgctccgaccatgacccgatcgaacaggtcaaggcgcggctcatc
gagaagaagtgggcaaccgaggacgagcttaagaccatcgacaaggaggtccgcgacatc
gtcgctgacgccgccgaatttgcccagaacgatgcagagccggatccgtccgagctctgg
accgatatcgtattgtaa

DBGET integrated database retrieval system