KEGG   Mesorhizobium ciceri: Mesci_3731Help
Entry
Mesci_3731        CDS       T01401                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mci  Mesorhizobium ciceri
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mci00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3880748..3881659)
Genome map
AA seq 303 aa AA seqDB search
MTPSPPFLGFPDRLADSHVPRAVIFGAGHGSTYPGRDSSGYALAANAIRAASQDDAAFVE
HWDFDLGGPLFDGKPASCIDAGDILTTMHDNAGNRARIEAKTREILTLPAVPILIGGDCS
MTIPFLAGFAEHGPVWVLQVDAHIDWRDEVHGERHGYSSPMRRASEMPHVAGMVQVGLRS
VGSARIAEIEAARRYGSRFVTAREVHAQGVEAALRHIPEAARVVVTLDCDSLDPSIMPGV
AARTPGGLTYTQVIDLIAGLGRRARIAGFDLVEFYPPADIDGLSALTAARLLVNVVGTVV
RQV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccccctcgcctccctttctcggctttcccgaccgtcttgcagatagccacgtccct
cgtgcggtaatcttcggggccggtcacggcagcacctatcccggcagggacagcagcggc
tatgccttggccgccaacgccatccgtgctgccagccaggacgatgccgcattcgtcgag
cactgggatttcgatcttggcggcccgctgttcgacggcaagccggcctcttgcatcgac
gccggcgatatcttgaccaccatgcatgacaatgccggcaaccgggccaggatcgaggca
aaaacgcgcgagatcctgacgttgccggctgtgccgatcctgatcggcggcgactgttcc
atgaccattcccttcctcgccggctttgcagagcacgggccggtctgggtcctgcaggtc
gacgcccatatagactggcgcgacgaggttcatggcgaacgccacggctattcgagcccg
atgcgcagggcaagcgagatgccgcatgtcgccggcatggtgcaggtcggtctgcgcagc
gtcggcagcgcgcgcatcgccgaaatcgaagcagcccggcgctatggcagccgcttcgtg
accgcccgcgaggttcatgcccagggcgtcgaggccgcgctacggcatattccggaagcc
gcgcgggtcgtcgtcaccctcgactgcgacagccttgatccaagcatcatgccgggcgtg
gcggcgcgtacaccgggcggcctcacctacacgcaggtaatcgacctgatcgccggcctc
ggcaggcgggccaggatcgcagggttcgaccttgtcgagttctatcctccggccgatatc
gacggcctgtcagcgctgaccgccgcgcgccttctcgtcaatgtggtcggcaccgtcgtc
cggcaggtttga

DBGET integrated database retrieval system