KEGG   Mesorhizobium ciceri: Mesci_3956Help
Entry
Mesci_3956        CDS       T01401                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00051  Fructose and mannose metabolism
mci00562  Inositol phosphate metabolism
mci00710  Carbon fixation in photosynthetic organisms
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
mci01230  Biosynthesis of amino acids
Module
mci_M00002  Glycolysis, core module involving three-carbon compounds
mci_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_3956
   00051 Fructose and mannose metabolism
    Mesci_3956
   00562 Inositol phosphate metabolism
    Mesci_3956
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_3956
Enzymes [BR:mci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mesci_3956
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mesci_3956
  Exosomal proteins of bladder cancer cells
   Mesci_3956
  Exosomal proteins of melanoma cells
   Mesci_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 10119444
NCBI-ProteinID: YP_004143121
UniProt: E8T9X6
Position
complement(4087139..4087906)
Genome map
AA seq 255 aa AA seqDB search
MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVCVPATLLAHAAEILSR
TPVHAGGEDCHTKESGAYTGCISAEMLRDAGASHVIVGHSECREQRGEDDATVQAKASAA
WRAGLVAIICVGETHEQREAGATLDVLSRQVEGSVPPSATPSNTIIAYEPVWAIGTGLTP
TAADVAAAHAHIREKLSEKLGGVAAKVRILYGGSVKPSNAVELLGVRNVDGALVGGASLK
AADFLGIAEAYRNIA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaggaattcgcccgctcgtcgccggcaactggaaaatgaacggcaccagcgcc
tccctcaacgagctcaggatgatcggcaacggcttcatgagtgggcttgacgcggagacc
gaagcgctggtttgcgttcccgcaaccctgcttgcccacgccgccgagatcctgtcgcgc
acgccggtgcatgccggcggcgaagattgccacaccaaggagagcggcgcctacaccggc
tgcatctcggcggaaatgctcagggatgccggtgcgagccatgtcatcgtcggccattcc
gaatgccgcgagcaacgcggcgaggatgacgccactgtccaggccaaggcatccgccgca
tggcgtgccgggcttgttgccatcatttgcgtcggcgaaacgcatgagcagcgtgaagcg
ggcgccacgctggacgtgctgtcgcggcaggtcgagggctcggtcccgccaagcgccacc
ccgtccaacaccatcattgcctatgagccggtatgggcgatcggcaccggcctgacgccg
acggcggccgacgtcgctgcggcacacgcacatatccgcgaaaagctgtcggaaaagctc
ggcggcgtcgcggcgaaggtgcgcattctctatggcggctcggtcaagccctccaacgcg
gtcgaactgctcggcgtcaggaatgtcgacggcgcgctggttggcggcgccagcctgaaa
gcggcggactttctcggcatcgccgaggcctatcgcaatattgcttga

DBGET integrated database retrieval system