KEGG   Mesorhizobium ciceri: Mesci_3956Help
Entry
Mesci_3956        CDS       T01401                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_3956
   01230 Biosynthesis of amino acids
    Mesci_3956
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_3956
   00051 Fructose and mannose metabolism
    Mesci_3956
   00562 Inositol phosphate metabolism
    Mesci_3956
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_3956
Enzymes [BR:mci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mesci_3956
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mesci_3956
  Exosomal proteins of bladder cancer cells
   Mesci_3956
  Exosomal proteins of melanoma cells
   Mesci_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4087139..4087906)
Genome map
AA seq 255 aa AA seqDB search
MTPGIRPLVAGNWKMNGTSASLNELRMIGNGFMSGLDAETEALVCVPATLLAHAAEILSR
TPVHAGGEDCHTKESGAYTGCISAEMLRDAGASHVIVGHSECREQRGEDDATVQAKASAA
WRAGLVAIICVGETHEQREAGATLDVLSRQVEGSVPPSATPSNTIIAYEPVWAIGTGLTP
TAADVAAAHAHIREKLSEKLGGVAAKVRILYGGSVKPSNAVELLGVRNVDGALVGGASLK
AADFLGIAEAYRNIA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgccaggaattcgcccgctcgtcgccggcaactggaaaatgaacggcaccagcgcc
tccctcaacgagctcaggatgatcggcaacggcttcatgagtgggcttgacgcggagacc
gaagcgctggtttgcgttcccgcaaccctgcttgcccacgccgccgagatcctgtcgcgc
acgccggtgcatgccggcggcgaagattgccacaccaaggagagcggcgcctacaccggc
tgcatctcggcggaaatgctcagggatgccggtgcgagccatgtcatcgtcggccattcc
gaatgccgcgagcaacgcggcgaggatgacgccactgtccaggccaaggcatccgccgca
tggcgtgccgggcttgttgccatcatttgcgtcggcgaaacgcatgagcagcgtgaagcg
ggcgccacgctggacgtgctgtcgcggcaggtcgagggctcggtcccgccaagcgccacc
ccgtccaacaccatcattgcctatgagccggtatgggcgatcggcaccggcctgacgccg
acggcggccgacgtcgctgcggcacacgcacatatccgcgaaaagctgtcggaaaagctc
ggcggcgtcgcggcgaaggtgcgcattctctatggcggctcggtcaagccctccaacgcg
gtcgaactgctcggcgtcaggaatgtcgacggcgcgctggttggcggcgccagcctgaaa
gcggcggactttctcggcatcgccgaggcctatcgcaatattgcttga

DBGET integrated database retrieval system