KEGG   Mesorhizobium ciceri: Mesci_3965Help
Entry
Mesci_3965        CDS       T01401                                 

Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
mci  Mesorhizobium ciceri
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Mesci_3965
Enzymes [BR:mci01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Mesci_3965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4097186..4098433
Genome map
AA seq 415 aa AA seqDB search
MSGIPDLAAVEAMDATDPLRAMRDRFILPEGVIYLDGNSLGAASHAVFGELQQAATQEWA
RDLIRAWNTAGWFEMPIELGDQLGRLIGAAAGQTVVCDTTSTNIYKVLHAAMEMRPGRSA
IVAEGDSFPTDLYIAEGVASTRDGVLLRLAGVDAPTIEELIDENVAVVLVNHVNYKSGEL
RDMAALTRRAHTAGALIVWDLCHTAGALPVELDQANADFAVGCTYKYLNGGPGAPAFIYA
AQRHHGDISQPLSGWWGHARPFAFERGYVAGTGIRRLLCGTQPVLSMRALKGALAIWSDV
DMAALRKKSVAQTELFIQLVEAKCGAYGLTLETTRDATRRGSQVSFLHDHGYQIMRALIE
RGVIGDFRAPSTIRFGFTPLYVSYKDVWLAVEVLEDILRTGAWKDQRFAVKEAVT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaattcctgatctcgccgcagtcgaagcgatggatgccacggatccgctgcgg
gccatgcgcgaccgtttcattctgccggagggggtgatctatctcgacggcaattcactg
ggggcagcatctcatgccgttttcggcgagctgcagcaggcggcgacgcaggaatgggcc
cgagatcttatccgagcctggaacacggccggatggttcgagatgccgatcgaactcggc
gaccaactcggacgcctgataggagccgcggccggccagaccgttgtctgcgacacgaca
tcgaccaacatctacaaggtgctgcacgcagcgatggagatgcggcccggccggtcagcc
atcgtcgccgaaggtgacagttttcccaccgacctgtacatcgccgaaggcgtggcctcg
acccgggatggcgtcctgctgcgcctcgcgggcgtcgacgcgccgaccatcgaagagttg
atcgacgaaaacgtggcggtggtgctggtcaaccacgtcaattacaaatcgggtgaactg
cgcgacatggcggcgctgacgcgcagggctcatacggccggagcgttgatcgtctgggat
ctctgccacaccgccggcgccctgcccgtcgagctcgatcaggcaaatgccgatttcgct
gtcggctgcacgtacaagtacctcaacggcggtccgggcgcgccggccttcatctatgcc
gcgcagcgccaccacggcgatatcagccagccgctcagcggctggtggggccatgcgcgg
ccctttgccttcgaacggggttatgttgccggcaccggcatccgccgtttgctgtgcggt
acgcaaccggtcctgtcgatgcgggcgctcaaaggcgcgcttgccatctggagcgacgtc
gacatggcggcattgcgaaagaagagcgtcgcgcagacagaactgttcatccagctcgtc
gaagccaagtgcggcgcctacggtctcacgctggagaccacccgcgacgcgaccaggcgc
ggcagccaggtgtcgttccttcacgaccacggctatcaaatcatgcgggcgctgatcgag
cgcggggtgatcggtgacttccgcgcaccgtcgaccatccgtttcggcttcacgccgctc
tatgtcagctacaaggatgtgtggctggcggttgaggttctggaagacattctgcgcacg
ggtgcatggaaggaccagcgtttcgccgtcaaggaagccgttacctga

DBGET integrated database retrieval system