KEGG   Mesorhizobium ciceri: Mesci_4028Help
Entry
Mesci_4028        CDS       T01401                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mesci_4028
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mesci_4028
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_4028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4158937..4160427)
Genome map
AA seq 496 aa AA seqDB search
MTGYILAIDQGTTSTRAILFDGDMKVAGSGQKEFTQHYPASGWVEHDPEDIWASVVTTVK
AALKNAGRAASEVAALGITNQRETVVIWDKATGKPIHNAIVWQDRRTTPLCQKLKKQGLE
KKFTKKTGLLLDPYFSGTKIAWMLDKVKGARRRAEKGELLAGTIDSFLIWRLTGGKVHAT
DATNASRTLVYNIEKNAWDNELLSILNIPAKMLPEVKDCADDYGITEKNLFGAEIRILGV
AGDQHAATIGQACFEPGMMKSTYGTGCFALLNTGSDLVRSKNRLLTTIAYRLNGKTTYAL
EGSIFIAGAAVQWLRDGIKVIGKAEQSGKLAAEADPTQNVYLVPAFVGLGAPHWDAEARG
AIFGLTRNSGPAEFARAALESVAYQTRDLLDAMRKDWKGASAKTVLRVDGGMVASDWTMQ
RLADILDAPVDRPTILETTALGAAWLAGSKAGVWPDAKKFAKSWALERRFQPAMDGSARA
AKLAGWRDAVRRTLSV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatacatccttgccatcgaccagggcacgacttcgacccgggcgatcctgttc
gacggcgatatgaaggttgccggcagcgggcagaaggaattcacccagcactatccggcc
tccggctgggtcgagcacgatcccgaagacatctgggcgagcgtggtgacgaccgtgaag
gcggcgctgaagaatgccggccgggctgcatccgaagtggccgcgctcggcatcaccaat
cagcgcgaaaccgtcgtcatctgggacaaggcgaccggcaagccgatccacaatgccatt
gtctggcaggaccggcgcaccacgccgctgtgccagaaactgaagaagcagggactggag
aaaaagttcaccaaaaaaaccggcctgctgcttgatccgtatttttccggtaccaagatc
gcctggatgctggacaaggtaaaaggggcgcggcgtcgtgccgagaagggcgagttgctc
gccggcaccatcgacagctttctgatctggcggctgaccggcggcaaggtccacgccacg
gacgcaaccaacgcctcgcgcacgctggtctacaacatcgagaaaaatgcctgggacaac
gaactgctgtcgatactgaacatcccggcaaaaatgctacccgaggtaaaagactgcgcc
gatgactatggaatcacggagaaaaatctcttcggcgccgagataagaatccttggcgtt
gccggcgaccagcacgcggcgaccatcggccaggcctgtttcgagccgggcatgatgaaa
tccacctacggcacgggctgctttgcgctgctcaacaccggcagcgaccttgtgcgttcg
aagaaccggctcttgaccactattgcctacaggctgaacggcaagaccacttatgcgctg
gagggctcgatcttcattgccggcgccgcggtccaatggctgcgcgacggcatcaaggtg
atcggcaaggccgagcaaagcggcaagctggctgccgaggctgatccaacgcaaaacgtc
tacctggtgccggccttcgtcgggctcggcgcgccgcattgggacgccgaggcacgcggc
gccattttcgggctgacgcgcaattccgggccggcggaattcgcccgcgccgcactcgaa
tccgtcgcctaccagacgcgcgacctgctcgacgccatgcgtaaggactggaagggagct
tcggccaagaccgtgctgcgggtcgacggcggcatggttgcgtcggactggaccatgcag
aggctggccgacatcctcgacgcgccggtcgaccgtccgaccatcctggagacgacggcg
ctgggtgccgcgtggctcgccgggtcgaaggcaggcgtgtggccggatgccaagaaattc
gcgaagagctgggcgctcgagcggaggttccagccggccatggatggctccgcgcgcgca
gccaaacttgctggttggcgcgatgctgtgcgccggacgctgagcgtgtag

DBGET integrated database retrieval system