KEGG   Mesorhizobium ciceri: Mesci_4097Help
Entry
Mesci_4097        CDS       T01401                                 

Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00790  Folate biosynthesis
mci01100  Metabolic pathways
Module
mci_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mesci_4097
Enzymes [BR:mci01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mesci_4097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CT_C_D
Motif
Other DBs
NCBI-GeneID: 10119586
NCBI-ProteinID: YP_004143260
UniProt: E8TC17
Position
complement(4226404..4227255)
Genome map
AA seq 283 aa AA seqDB search
MTARRWQLAHGRHLDLGGKAVVVGILNVTPDSFSDGGQFDAPEKALAQARRMIGEGALVV
DVGGESTRPGAAAVSASQEQARILPVIEALAGVNEVLISVDTYRADTARLAVAAGAHIVN
DVWGLQREPDIARVAADTGAGLVIMHTGRDRQKLPDAIADQLAFLRRSLEIARQTGIADD
HIVLDPGFGFAKETAEENLDLMARFSELHALGLPLMAGTSRKRFIGTVTGRDAADRGVGT
AATSVILRLQGADLFRVHDVAFNVDALALADAMLARQTDRARN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaggcgatggcagttggcgcatggacgccatctcgaccttggcggcaaggcc
gtggtcgtcggcatcctcaatgtcacgcccgacagcttttccgacggcggccagttcgac
gcccctgaaaaggcgctggcccaggcgcgccgcatgatcggggaaggggcactggttgtc
gatgtcgggggagaatcgacgcgcccaggtgctgccgcggtatcggccagccaggaacag
gcccgcatcctgccggtgatcgaagcgctggcgggcgtgaacgaggtgctgatttcggtc
gatacctatcgcgccgacacggcgcggctggcggtcgccgccggcgcgcatatcgtcaac
gatgtctggggtttgcagcgcgagcccgatattgctcgtgtcgccgccgataccggcgcc
gggcttgtcatcatgcataccgggcgggatcgccagaagctgccggacgcgattgccgat
cagttggcattcctgcgaaggtcgctggaaatcgcccgccagaccggcatcgccgatgat
cacatcgtgctcgatcccggtttcggattcgccaaggagacggcggaggaaaatctcgac
ctgatggcacgcttttcggaattgcatgcactcggcctgccgctgatggccggcacgtcg
cgaaaacgcttcatcggcacggtcaccggccgtgatgccgccgacagaggggtcggaaca
gcggcgaccagcgtcattttgaggctccagggcgccgacctgtttcgcgtccacgatgtc
gcattcaacgtggacgcattggcgctcgccgatgctatgctggcgcgtcaaaccgaccgg
gcgagaaactga

DBGET integrated database retrieval system