KEGG   Mesorhizobium ciceri: Mesci_4126Help
Entry
Mesci_4126        CDS       T01401                                 

Definition
(RefSeq) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mci  Mesorhizobium ciceri
Brite
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mesci_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4262363..4263430
Genome map
AA seq 355 aa AA seqDB search
MQPAAVPTERTDIAATVVATMRQLGVLGLPRNYEIFYEALSGTNRELSLAVVSLSSRPTQ
DELDQIGRTFFAHNHGPGIVEHARDVIARELEAVASLLRSERSHIEKYGRILDETSSGLN
GRSLLSQDLLHKIANAMAVATNSTIDHGRQVASTLSDKTAELETVKSKLEEYKRLADTDP
LTHIWNRRAFDKEITRIYNSNRGILFNALVLADIDRFKDINDRFGHPVGDKIIQSIADIF
QTSIRGDMFVARTGGEEFALIVEGASEDATYDVAERIRALIEQTPFTSSQTGTNYGTVTV
SMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVTRHSTMAGRAGKSWLLYKKD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcagctgtcccgaccgaacgcaccgacatcgcagccactgttgtcgcgaca
atgcgccagttgggcgtgctcggcctgccgcgcaattacgagatcttctatgaggccctg
agcggcaccaatcgcgaactcagcctggccgtcgtttcgctgagcagccggccgacacag
gatgaactggatcagatcgggcgcactttctttgcccacaaccatggtcccggcatcgtc
gagcatgcccgagacgtcattgccagggagctcgaggcggttgcttcactgctgcggagc
gagcgcagccatatcgagaaatacggcaggatcctcgatgagacatcgagcggcctcaac
ggccgcagccttctttcccaggatcttttgcacaagatcgccaacgccatggcggttgcc
accaattcgacgatcgatcacggccggcaggtggcctcgacgctcagcgacaagacggcc
gaactcgagaccgtcaaatcgaagctcgaggaatacaaacggttggccgacaccgatccc
ttgacccacatctggaatcgccgcgccttcgacaaggaaatcaccaggatctacaacagc
aacaggggtatcctgttcaacgccctggtccttgccgacatcgaccgcttcaaggacatc
aacgaccgcttcggccacccggtcggcgacaagatcatccagagcatcgccgatatcttc
cagaccagcattcgcggcgacatgttcgttgctcgcaccggcggcgaggagttcgcgctg
atcgtcgagggcgccagcgaggacgccacctatgacgttgcagagcgtattcgtgccctg
atcgagcagacgccgttcaccagcagccagacgggcacgaattacggcaccgtcaccgtc
tcgatgggtatctgcatggcgtccgaagccgaaggacccgaagatctctacaccaaggcc
gaccgggcgctctatcgctcgaaggtcagcggccgcaaccgcgtcaccaggcactcgacg
atggctggccgagccggcaagagctggctgctctacaagaaggactga

DBGET integrated database retrieval system