KEGG   Mesorhizobium ciceri: Mesci_4126Help
Entry
Mesci_4126        CDS       T01401                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mci  Mesorhizobium ciceri
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4262363..4263430
Genome map
AA seq 355 aa AA seqDB search
MQPAAVPTERTDIAATVVATMRQLGVLGLPRNYEIFYEALSGTNRELSLAVVSLSSRPTQ
DELDQIGRTFFAHNHGPGIVEHARDVIARELEAVASLLRSERSHIEKYGRILDETSSGLN
GRSLLSQDLLHKIANAMAVATNSTIDHGRQVASTLSDKTAELETVKSKLEEYKRLADTDP
LTHIWNRRAFDKEITRIYNSNRGILFNALVLADIDRFKDINDRFGHPVGDKIIQSIADIF
QTSIRGDMFVARTGGEEFALIVEGASEDATYDVAERIRALIEQTPFTSSQTGTNYGTVTV
SMGICMASEAEGPEDLYTKADRALYRSKVSGRNRVTRHSTMAGRAGKSWLLYKKD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgcagccggcagctgtcccgaccgaacgcaccgacatcgcagccactgttgtcgcgaca
atgcgccagttgggcgtgctcggcctgccgcgcaattacgagatcttctatgaggccctg
agcggcaccaatcgcgaactcagcctggccgtcgtttcgctgagcagccggccgacacag
gatgaactggatcagatcgggcgcactttctttgcccacaaccatggtcccggcatcgtc
gagcatgcccgagacgtcattgccagggagctcgaggcggttgcttcactgctgcggagc
gagcgcagccatatcgagaaatacggcaggatcctcgatgagacatcgagcggcctcaac
ggccgcagccttctttcccaggatcttttgcacaagatcgccaacgccatggcggttgcc
accaattcgacgatcgatcacggccggcaggtggcctcgacgctcagcgacaagacggcc
gaactcgagaccgtcaaatcgaagctcgaggaatacaaacggttggccgacaccgatccc
ttgacccacatctggaatcgccgcgccttcgacaaggaaatcaccaggatctacaacagc
aacaggggtatcctgttcaacgccctggtccttgccgacatcgaccgcttcaaggacatc
aacgaccgcttcggccacccggtcggcgacaagatcatccagagcatcgccgatatcttc
cagaccagcattcgcggcgacatgttcgttgctcgcaccggcggcgaggagttcgcgctg
atcgtcgagggcgccagcgaggacgccacctatgacgttgcagagcgtattcgtgccctg
atcgagcagacgccgttcaccagcagccagacgggcacgaattacggcaccgtcaccgtc
tcgatgggtatctgcatggcgtccgaagccgaaggacccgaagatctctacaccaaggcc
gaccgggcgctctatcgctcgaaggtcagcggccgcaaccgcgtcaccaggcactcgacg
atggctggccgagccggcaagagctggctgctctacaagaaggactga

DBGET integrated database retrieval system