KEGG   Mesorhizobium ciceri: Mesci_4488Help
Entry
Mesci_4488        CDS       T01401                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mci  Mesorhizobium ciceri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mesci_4488
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mesci_4488
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_4488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4614623..4615654
Genome map
AA seq 343 aa AA seqDB search
MNKFTPAKPAGARGVDEITGSRRLRRMRKADWSRRLVQENRLTVDDLIWPIFVVEGKGIR
EPIAAMPGVFRLSIDLAVKEAERAAKLGIPALATFPNVDISLRDQTGSHILDPDNVINRA
TRAIKDAVPQIGIITDAALDPFTSHGHDGILRDGIIVNDETVEQVTAAAVIQAAAGADII
APSDMMDGRIGAIRDALDANGFQDVAIMSYATKFASAFYGPYREAVGTAGLLKGDKKTYY
IDHANSDEAVREAEQDIAEGADMLMVKPGLPYLDIIRRLKDEFQMPTFAYQVSGEYSMIK
AAGANGWIDGEKAMLESLLAFKRAGCDGILTYFAPEVAEMLKG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcacccccgcaaagcccgccggcgcgcgcggcgtcgacgagatcaccggc
agccgccgtctgcgccgcatgcgcaaggccgactggtcgcgccgtctggtgcaggagaac
cggctcacggtcgacgatttgatctggccgatcttcgtcgtcgagggcaagggtatccgc
gagcctatcgccgccatgcccggcgtcttccgcctgtcgatcgatctcgccgtcaaggag
gcagagcgcgcggcaaaactcggcattccggcactcgccaccttccccaatgtggacatc
tcgctgcgcgaccagaccggctcgcacatcctcgatcccgacaatgtcatcaaccgcgcc
acccgcgcgatcaaggatgcggtaccgcagatcggcatcatcaccgacgcagcgctcgac
ccattcaccagccacggccatgacggcatcctgcgcgacggcatcatcgtcaacgacgag
acagtggaacaggtgaccgccgccgccgtcatccaggcggccgccggcgccgacatcatc
gcaccgtccgacatgatggacggccgcatcggcgccatccgcgacgcgctcgatgccaat
ggttttcaggacgtggcgatcatgtcctatgcgaccaaattcgcctcggccttctacgga
ccctatcgcgaggcggtgggcaccgccggtctgctcaagggcgacaagaagacctattac
atcgaccatgccaattcggacgaggcggtgagggaggccgaacaggacatcgccgagggc
gccgacatgctgatggtcaagcccggcctgccctatctcgacatcatccggcggctgaag
gacgagttccagatgccgaccttcgcctatcaggtgtcgggcgaatattcgatgatcaag
gcggcaggtgccaatggctggatcgacggcgagaaggcaatgctcgaatcgctcctcgcc
ttcaagcgcgccggctgcgacggcatcctgacctatttcgcacccgaagtggcggagatg
ctgaaggggtaa

DBGET integrated database retrieval system