KEGG   Mesorhizobium ciceri: Mesci_4746Help
Entry
Mesci_4746        CDS       T01401                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00230  Purine metabolism
mci01100  Metabolic pathways
Module
mci_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mesci_4746
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mesci_4746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 Thymidylate_kin ABC_tran AAA_29 RsgA_GTPase cobW TsaE
Motif
Other DBs
NCBI-GeneID: 10120243
NCBI-ProteinID: YP_004143905
UniProt: E8TKN5
Position
complement(4873662..4874318)
Genome map
AA seq 218 aa AA seqDB search
MVAKDLGSRIRRRGLMLVLSSPSGAGKSTIARNLLESDSSLELSVSVTTRPRRGSEIEGV
HYHFRTMREFERLRDSDALLEWAEVHGNCYATPREPAELALSEGRDMLFDIDWQGAQQLK
EKMRADIVSIFILPPSMKELKARLKRRAEDQEAVIETRLKNARNEIEHWKEYDFVIVNDD
LDRAFAEVRGIVVAERLRRDRRPGLFDFVSGLLDEKTG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggttgccaaggatttggggtcccgcattcgccgccggggcctgatgctcgtcctgtcg
tcgccgtccggcgccggcaagtcgacgatcgcgcgcaatcttctggaaagcgattccagc
ctcgaactgtcggtctcggtcaccaccaggccgcgccgcggcagcgagatcgaaggcgtc
cactatcatttccggacgatgcgcgaattcgagcggcttcgtgattcagacgcgctgctg
gagtgggccgaggtgcatggcaattgctatgcgacaccgcgcgagcctgccgaactggcg
ctgtctgaagggcgcgacatgctgttcgacatcgactggcagggcgcccagcagctcaag
gagaagatgcgcgccgacatcgtctcgatcttcatcctgccgccatcgatgaaggagttg
aaggcacggctgaagcgccgcgccgaagaccaggaagcggtgatcgaaacgcggttgaaa
aacgcccgcaacgagatcgagcactggaaggaatatgatttcgtcatcgtcaatgacgac
ctcgaccgcgccttcgccgaagtgcgcggcatcgtcgtcgccgagcggctgagacgcgac
cgccggccaggcctgttcgatttcgtctcgggactgttggacgagaagacgggttga

DBGET integrated database retrieval system