KEGG   Mesorhizobium ciceri: Mesci_4926Help
Entry
Mesci_4926        CDS       T01401                                 

Definition
(RefSeq) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00030  Pentose phosphate pathway
mci00051  Fructose and mannose metabolism
mci00052  Galactose metabolism
mci00230  Purine metabolism
mci00500  Starch and sucrose metabolism
mci00520  Amino sugar and nucleotide sugar metabolism
mci00521  Streptomycin biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_4926
   00030 Pentose phosphate pathway
    Mesci_4926
   00051 Fructose and mannose metabolism
    Mesci_4926
   00052 Galactose metabolism
    Mesci_4926
   00500 Starch and sucrose metabolism
    Mesci_4926
   00520 Amino sugar and nucleotide sugar metabolism
    Mesci_4926
  Nucleotide metabolism
   00230 Purine metabolism
    Mesci_4926
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesci_4926
Enzymes [BR:mci01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mesci_4926
    5.4.2.8  phosphomannomutase
     Mesci_4926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 10120424
NCBI-ProteinID: YP_004144081
UniProt: E8TNN6
Position
complement(5063890..5065410)
Genome map
AA seq 506 aa AA seqDB search
MSFSIVGDARPNSFEFETEALIKPSGFREYDARWWFGHPGSAQLPELNLNGVQALGMGLG
TLIRRVGAGPDIVTGHDFRSYSLGIKLALVSGLMAAGARVRDIGLALSPMAYFAQFALDV
PSVAMVTASHNENGWTGVKMGAARPLTFGPEEMSALKQIVLAGDFDLVGGGSYDFVRDFR
ATYLDDLTEDKRITRKLKVVAACGNGTAGAFAPQALQRIGCEVIPLDVELDHTFPRYNPN
PEDMQMLHAIRDKVLETGADVGLGFDGDGDRCGVVDNEGNEIFADKVGVMLARDISSQHP
GSTFVVDVKSTGLFNTDSVLRANSAVTDYWKTGHSYIKRRVAELGAVAGFEKSGHFFFNP
PIGRGYDDGLVTAIAICQMLDRSPGSSMADLYRALPLTFGTPTMSSHCADDVKYGVVERV
VADFQAMKRDGTVFAGQKIADLITVNGARVVADDGTWGLVRASSNKPELVVVVESPVSSQ
RRREMFEAVDTVLRRSPEVGAYNQTF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttcagcatcgttggcgacgcccggcccaacagtttcgagttcgaaaccgaagcg
ctgatcaagccatccggctttcgagaatatgatgcgcgctggtggtttggccatcccggc
tccgcgcaactgccggagctcaatctgaatggcgtccaggcgctcggaatggggcttggc
acgctgatccgccgtgtcggtgccggtcccgatatcgtcaccgggcacgatttccgctcc
tattcgcttggcatcaagctggcgctggtgtccggtttgatggctgcaggcgctcgggtg
agggacatcggactggcgttgtcgccgatggcctatttcgcccagttcgcactggacgtg
ccttcggtcgctatggtcaccgcctcgcataacgagaatggctggaccggcgtcaagatg
ggtgcggcgcggccgctgactttcgggccggaagagatgagcgcgctgaagcagattgta
ctggccggcgatttcgatctcgtcggcggcggctcctacgatttcgttcgcgattttcgc
gctacttatctcgacgatctgaccgaggacaagcgcatcacccgaaagctgaaagtggtc
gccgcctgcggcaacggcaccgccggcgccttcgcgccgcaagcgctgcagcgcatcggc
tgcgaggtcatcccgctcgatgtcgaactcgaccacacctttccgcgctacaatcccaat
cccgaggatatgcagatgctgcatgccatcagggacaaggtgcttgagactggagccgat
gtcggccttggcttcgacggtgacggcgaccgctgcggcgtcgtcgacaatgagggcaat
gagatttttgccgacaaggtcggtgtgatgctggcgcgcgatatctccagccagcatccg
ggctcgaccttcgtcgtcgacgtcaagtcgaccggcctgttcaacacagacagcgtgctg
cgcgccaacagcgccgtcaccgactactggaagaccggccactcctacatcaagcgccgc
gtcgccgagcttggcgccgtcgccggtttcgaaaagtcgggccatttcttcttcaacccg
ccgatcgggcggggttatgacgatgggctggtcaccgccattgccatctgccagatgctg
gaccgcagccccggcagttcgatggccgatctataccgcgcgctgccgctgaccttcggc
acgccgaccatgtcgtcgcactgcgcggacgatgtgaagtatggcgttgtcgagcgggtg
gttgccgactttcaggccatgaagcgggatggaacggtttttgcgggccagaagatcgcc
gacctcatcaccgtcaacggtgcgcgcgttgtcgcggacgacggcacctggggactggtg
cgcgcctcgtcgaacaagccggaactggtcgtggtcgtcgaaagcccggtgtcgtcgcag
cgtcgacgggagatgttcgaggctgtcgacaccgtgctgcgccgcagccccgaggtgggc
gcctacaaccagaccttttga

DBGET integrated database retrieval system