KEGG   Mesorhizobium ciceri: Mesci_4942Help
Entry
Mesci_4942        CDS       T01401                                 

Definition
(RefSeq) 1,4-alpha-glucan branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00500  Starch and sucrose metabolism
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mesci_4942
Enzymes [BR:mci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mesci_4942
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mesci_4942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 10120441
NCBI-ProteinID: YP_004144097
UniProt: E8TNQ2
Position
complement(5084294..5086507)
Genome map
AA seq 737 aa AA seqDB search
MKKPRATAATSGPDGLAPAGDVAAIVAGTHGDPFAVLGVHEVGKSLYARCFVPNAEFVTA
YTLTGTIAGELSRRNDGGFFEGKLSIKKRQPLRYHARNAGGDWWLTDPYSFGPVLGPMDD
YYIAQGSHLRLFDKLGAHVIDHEGATGVHFAVWAPNARRVSVVGDFNEWDGRRHTMRDRR
DTGIWELFIPDIGAGRPYKYEIIGPDGVRLPLKADPFAFKSELRPATASVVAVPPAHEWG
DEAHRNFWRNADHRREAISIYEVHAGSWQLRDDGTFLSWDELADRLIPYVVETGFTHIEF
MPISEHPYDPSWGYQTTGLYAPSARFGDPDGFARFVDGAHRAGVGVILDWVPAHFPVDAH
GLANFDGTALYEHADPRKGFHPDWNTAIYNFGRREVVSFLVNNALFWAEKYHVDGLRVDA
VASMLYLDYSRKAGEWIPNEKGGRENLEAVSFLQKMNKEVYGHHPGVMTIAEESTSWPKV
SAPVHEGGLGFGFKWNMGFMHDTLEYFSKEPIFRKHHHNDLTFGLTYAFSENFVLPLSHD
EVVHGKGTLLGKMAGDDWQKFATLRAYYAFMWGYPGKKLLFMGQEFAQRREWSEARALDW
NLLEFRPHRGVWQTVRDLNYLYRSRPALHGRDCEPEGFSWLIVDDSQNSVFAWLRSAPGG
SPVAVISNFTPVPRDNYRVPLPTSGKWREIINTDASEYGGSGKGNGGMVEARAEEGSIAA
TMLLPPLSTIMLELVAD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagccgcgcgcgaccgctgcgacaagcgggccggatggactggcgccagccggc
gatgttgcggcgattgttgccggcacgcacggagatcccttcgccgtccttggtgtccat
gaggtcggcaagagcctgtatgcccggtgctttgttccgaatgccgaattcgtcaccgcc
tacacgctgaccggcaccatcgcgggtgaactgtccaggcgcaacgatggcggctttttc
gaaggcaagctctcgatcaagaagcggcaacccctgcgctatcatgccaggaacgccggc
ggcgactggtggctgaccgatccctattcgttcggtccggtgctgggcccgatggacgat
tactacatcgcccaaggctcgcatctcaggctgttcgataagctcggcgcccatgtcatt
gatcacgaaggcgccaccggagtgcatttcgccgtctgggctcccaatgcgcggcgcgtc
tcggtggtcggcgacttcaacgagtgggacggccgccggcacaccatgcgagaccgccgc
gacaccggcatctgggaactgttcatacccgacatcggtgccggacgaccctacaaatac
gagatcatcggccccgatggtgtgaggctgccgctgaaggccgacccgttcgccttcaaa
tccgaactgcgtccggctactgcttcggtcgtggcggtgccgccggcgcacgagtggggc
gacgaggcgcatcgcaatttctggcgcaatgccgatcaccggcgagaagccatctcgatc
tacgaggtccatgccggctcctggcagcttcgcgacgacggaacgttcctgtcatgggac
gagttggccgaccggctgatcccctatgtggttgagaccggtttcacccacatcgaattc
atgccgatctctgaacatccctacgacccgtcctggggctaccagacgaccggcctttac
gcgccatcggcccgctttggcgacccggacggctttgcccgtttcgtcgatggcgcccac
cgcgccggcgtcggcgtcatcctcgactgggtgccggcacatttcccggtcgacgcgcat
ggcctggccaatttcgatggcaccgcgctctatgaacatgccgatccgcgcaagggtttt
catcccgactggaacaccgcgatctacaatttcggccgccgcgaggtggtgtcgttcctg
gtcaacaatgcgctgttctgggccgagaaataccatgtcgacggtttgcgcgtcgacgcg
gtcgcctcgatgctctacctcgactattcacgcaaggccggcgaatggatccccaacgag
aagggcggccgcgagaatctcgaggcggtcagcttcctgcagaagatgaacaaggaggtc
tacggccatcatccgggcgtcatgaccatagccgaggaatcgacctcatggccgaaggtc
tcggcaccggtgcatgaaggcggcctcggcttcggcttcaagtggaatatgggcttcatg
cacgacacgctggagtatttctccaaggagccgatcttccgaaagcaccaccacaacgac
ctcaccttcggcctgacctacgccttctcggagaatttcgtgctgccgctctcgcatgac
gaggttgtgcacggcaaaggcacgttgcttggcaagatggccggcgacgactggcagaag
tttgcgacgctacgcgcctactacgctttcatgtggggctatcccggcaagaagctgctt
ttcatggggcaggagttcgcgcagcgccgcgaatggagcgaggcgcgcgcgctcgactgg
aacctgcttgaattccggccgcatcgcggcgtttggcagacggtgcgcgatctcaactat
ctctaccgttcgcgcccggcgctgcatggccgcgactgcgaaccggaagggttttcctgg
ctgatcgtcgacgacagccagaattcggtttttgcctggctgcgcagcgcgccgggcggc
agcccggtggccgtcatttccaatttcacgccggtgccgcgcgataattatcgcgtgccg
ttgccgacatcaggcaaatggcgcgagatcatcaacaccgacgcttctgaatatggcggt
tccggcaagggcaatggcggcatggtcgaggcacgggcggaggaaggaagcatcgccgcg
acgatgctcttgccgccgctgtccacgatcatgctcgagctcgtcgccgactga

DBGET integrated database retrieval system