KEGG   Mesorhizobium ciceri: Mesci_5007Help
Entry
Mesci_5007        CDS       T01401                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_5007
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_5007
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesci_5007
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mesci_5007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5158766..5160163
Genome map
AA seq 465 aa AA seqDB search
MHYVSTRGEAPVLGFSDAVLAGLARDGGLYVPREWPQFSAAEIRAMRDLAYPDLAIRVLS
PFLGGEIPAPVFERLVREAYATFRHEAVCPLVQTGPNTFVLELFHGPTLAFKDVAMQLLA
RLMDHVLAERDQHATIVGATSGDTGGAAIDAFAGRSRTDIFILFPHGRVSPVQQRQMTTS
TAANVHALAIEGNFDDCQGLLKDMFNDHGFRDRVALSGVNSINWARIMAQIVYYFSSALS
LGAPDRPVSFTVPTGNFGDIFAGYAAKKMGLPIDRLVIATNDNDILARTFSTGEYRTKGV
FATTSPSMDIQVSSNFERLLFEASGRDAATVRRYMDGLKQSGAFTIEPHQIAGMRSEFDA
GRADMDEVAATIRSTLATSNYLLDPHTAAAVHVAAGKASGAVPMVVLGTAHPAKFPAAVE
AASGVSPALPAWLGGLMTSEEKYTVLPSDLKMVEDYVGRRARAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcactatgtgagtacccgcggggaagcccccgttcttggattttccgacgccgtgctg
gctgggctggcgcgcgacggcgggctctacgtgccgcgcgagtggccacagttttccgcc
gccgagatccgcgccatgcgcgaccttgcctatcccgaccttgccatccgcgtgctgtcg
ccgttccttggcggcgaaatcccggcgcccgtcttcgagcggctggtccgcgaagcctat
gccaccttccgccacgaggccgtctgcccgctggtgcagaccggccccaacaccttcgtc
ctggaactcttccacgggccgacgctcgccttcaaggacgtggcgatgcagcttctggcc
cggctgatggaccatgtgcttgccgaacgcgaccagcacgccaccatcgtcggcgccacc
tcgggcgataccggcggggcggccatcgatgcctttgccggtcgcagccggaccgacatc
ttcatccttttcccgcatggccgcgtctcgccggtgcagcagcggcaaatgacgacgtcg
acggctgcaaacgtccatgcgctggcgatcgaaggcaatttcgacgattgccagggcctg
ctcaaggacatgttcaacgatcacggctttcgcgaccgggtggcgctttcgggcgtcaat
tcgatcaattgggcccgcatcatggcccagatcgtctattatttctcctcggcgctgtcg
ctcggcgcgccggacaggccggtttccttcaccgtgccgaccggcaatttcggcgatatc
tttgccggctatgccgccaagaagatgggcttgccgatcgatcggctggtcattgccacc
aatgacaacgacatcctggcgcgcactttttcgaccggcgaataccgcaccaagggcgtc
tttgcgaccacgtcgccgtcgatggatatccaggtgtcgtcgaatttcgaacgcttgctg
ttcgaggcctccggccgtgacgccgcgaccgtgcggcgctacatggacggcctgaagcag
tccggtgctttcaccatcgaaccccaccaaattgccgggatgcggtccgaattcgacgcc
ggccgcgctgatatggacgaggtcgccgccaccatccgctcgacgctcgcgaccagcaac
tatctgctcgatccgcacactgcggcagccgtgcatgtcgccgcaggcaaggcgtcaggc
gccgtgccgatggtggtgctgggtacagcgcacccggcaaaattcccggccgccgtcgaa
gccgccagcggcgtgtcgcccgcactgcccgcgtggctaggtgggttgatgacatcggag
gaaaaatacacggtacttccatccgacctgaaaatggtggaagattacgtcggccgccgc
gcgcgggcggcgcgttag

DBGET integrated database retrieval system