KEGG   Mesorhizobium ciceri: Mesci_5007Help
Entry
Mesci_5007        CDS       T01401                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mesci_5007
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mesci_5007
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mesci_5007
Enzymes [BR:mci01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mesci_5007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5158766..5160163
Genome map
AA seq 465 aa AA seqDB search
MHYVSTRGEAPVLGFSDAVLAGLARDGGLYVPREWPQFSAAEIRAMRDLAYPDLAIRVLS
PFLGGEIPAPVFERLVREAYATFRHEAVCPLVQTGPNTFVLELFHGPTLAFKDVAMQLLA
RLMDHVLAERDQHATIVGATSGDTGGAAIDAFAGRSRTDIFILFPHGRVSPVQQRQMTTS
TAANVHALAIEGNFDDCQGLLKDMFNDHGFRDRVALSGVNSINWARIMAQIVYYFSSALS
LGAPDRPVSFTVPTGNFGDIFAGYAAKKMGLPIDRLVIATNDNDILARTFSTGEYRTKGV
FATTSPSMDIQVSSNFERLLFEASGRDAATVRRYMDGLKQSGAFTIEPHQIAGMRSEFDA
GRADMDEVAATIRSTLATSNYLLDPHTAAAVHVAAGKASGAVPMVVLGTAHPAKFPAAVE
AASGVSPALPAWLGGLMTSEEKYTVLPSDLKMVEDYVGRRARAAR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcactatgtgagtacccgcggggaagcccccgttcttggattttccgacgccgtgctg
gctgggctggcgcgcgacggcgggctctacgtgccgcgcgagtggccacagttttccgcc
gccgagatccgcgccatgcgcgaccttgcctatcccgaccttgccatccgcgtgctgtcg
ccgttccttggcggcgaaatcccggcgcccgtcttcgagcggctggtccgcgaagcctat
gccaccttccgccacgaggccgtctgcccgctggtgcagaccggccccaacaccttcgtc
ctggaactcttccacgggccgacgctcgccttcaaggacgtggcgatgcagcttctggcc
cggctgatggaccatgtgcttgccgaacgcgaccagcacgccaccatcgtcggcgccacc
tcgggcgataccggcggggcggccatcgatgcctttgccggtcgcagccggaccgacatc
ttcatccttttcccgcatggccgcgtctcgccggtgcagcagcggcaaatgacgacgtcg
acggctgcaaacgtccatgcgctggcgatcgaaggcaatttcgacgattgccagggcctg
ctcaaggacatgttcaacgatcacggctttcgcgaccgggtggcgctttcgggcgtcaat
tcgatcaattgggcccgcatcatggcccagatcgtctattatttctcctcggcgctgtcg
ctcggcgcgccggacaggccggtttccttcaccgtgccgaccggcaatttcggcgatatc
tttgccggctatgccgccaagaagatgggcttgccgatcgatcggctggtcattgccacc
aatgacaacgacatcctggcgcgcactttttcgaccggcgaataccgcaccaagggcgtc
tttgcgaccacgtcgccgtcgatggatatccaggtgtcgtcgaatttcgaacgcttgctg
ttcgaggcctccggccgtgacgccgcgaccgtgcggcgctacatggacggcctgaagcag
tccggtgctttcaccatcgaaccccaccaaattgccgggatgcggtccgaattcgacgcc
ggccgcgctgatatggacgaggtcgccgccaccatccgctcgacgctcgcgaccagcaac
tatctgctcgatccgcacactgcggcagccgtgcatgtcgccgcaggcaaggcgtcaggc
gccgtgccgatggtggtgctgggtacagcgcacccggcaaaattcccggccgccgtcgaa
gccgccagcggcgtgtcgcccgcactgcccgcgtggctaggtgggttgatgacatcggag
gaaaaatacacggtacttccatccgacctgaaaatggtggaagattacgtcggccgccgc
gcgcgggcggcgcgttag

DBGET integrated database retrieval system