KEGG   Mesorhizobium ciceri: Mesci_5082Help
Entry
Mesci_5082        CDS       T01401                                 

Definition
(RefSeq) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00900  Terpenoid backbone biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mesci_5082
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mesci_5082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 10120582
NCBI-ProteinID: YP_004144232
UniProt: E8T924
Position
5230273..5231172
Genome map
AA seq 299 aa AA seqDB search
MDTDIGSRSWHAHAKINLALHVTGRRPDGYHLIESLAVFTRFGDRVEIAPADSDEFTVSG
RYAPAVPLDASNLVPRARDALRQAVGHERTPPVAIRLEKNLPAASGVGGGSSDAATVLRG
LVETWGLDIDGAELARIGLSLGADVPMCLAARPLVARGIGDDLSMVPDFSALGLVLVNPG
MPVSTAEVFAALSRRDNEALPPLPRSIDFHSLRNWLEITRNDLEPAALAMQPAIGRALSW
LNKAGSGFSRMSGSGATCFGLFETGNVAKRAAAEIRGRQPDWFVAATRSIASEGSDGQN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gtggacaccgacatcgggtcgcgtagctggcacgcgcacgccaagatcaatcttgcgctg
catgtcaccggcaggcgacctgacggctatcatctgatcgagagcctggcggtgttcacg
cggtttggcgacagggtcgaaatcgcgcctgccgacagcgatgaatttaccgtgtccggc
cgctacgccccggcggttcctctcgacgccagcaatctggtgcctagggcgcgcgatgcc
ctgcgacaggcggtcggacacgagagaacaccgccggtcgctatccggctggaaaagaac
ctgccggctgcctccggcgtcggcggcggttcgagcgacgcggcgacggtgctgcgcgga
ctggtggagacatggggcctggatatcgatggcgcagagctggcgcggatcggcctctcg
ctcggcgccgatgtgccgatgtgcctggcggccagacctctggtcgcgcgcggcatcggg
gatgacctgtcgatggtgccggatttttcggcgcttgggctggtgctggtcaatccaggc
atgccggtctcgacggccgaggtcttcgcagcgctttcgcgtcgtgacaacgaagccttg
ccgccgctgccgcgcagcatcgatttccacagcctgcgcaactggctggagatcacccgc
aacgatctcgagcccgccgcgctggcgatgcagcccgcgatcggcagggcgctttcctgg
ctgaacaaggccggatcgggtttttcacggatgtccgggtccggcgccacctgcttcggc
ctgttcgagaccggcaatgtcgccaagcgcgccgccgccgaaatccgcggccgccagccc
gactggttcgtcgcggcgacgcgcagcatcgcatcggagggatctgatggccagaattga

DBGET integrated database retrieval system