KEGG   Mesorhizobium ciceri: Mesci_5191Help
Entry
Mesci_5191        CDS       T01401                                 

Definition
(RefSeq) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00010  Glycolysis / Gluconeogenesis
mci00052  Galactose metabolism
mci00500  Starch and sucrose metabolism
mci00520  Amino sugar and nucleotide sugar metabolism
mci00521  Streptomycin biosynthesis
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
Module
mci_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_5191
   00052 Galactose metabolism
    Mesci_5191
   00500 Starch and sucrose metabolism
    Mesci_5191
   00520 Amino sugar and nucleotide sugar metabolism
    Mesci_5191
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mesci_5191
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mesci_5191
Enzymes [BR:mci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mesci_5191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N DUF4445
Motif
Other DBs
NCBI-GeneID: 10120691
NCBI-ProteinID: YP_004144339
UniProt: E8TA84
Position
complement(5349893..5350921)
Genome map
AA seq 342 aa AA seqDB search
MTTEAALAIDLGGTELRAALVDREGKILAFAAVPTQAQAGPDVVIGQIEALAATVHAEAP
ALSVVGVGVGAPGPLDPLAGIAVGPPTLTGWLDVPLADILERRLGLPVRLENDANAAALG
EWRFGAGHGARSLVFVTVSTGIGGGVVVDGRILHGRRGLAAEIGHMTITNEGERCVCGVI
GCFEAIASGTALGRRATAATAAGDGSALRRLSADAEVTGRHVVEAARLRDDLASALLDEE
ARWLGVGFTNLLHLYSPDVLVVGGGIANGLDLMAPTIEATIRQRAMRAYRDVPVVPAQLG
RHAGLVGAASLVLFDDEGTIAARMPVGPSTYPDTPLSKIGTV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggaagccgcccttgcgatcgatcttggcgggacggagcttcgcgccgccttg
gtcgaccgcgaaggcaagatcctggcattcgcggcggtgccgacgcaggcgcaggccggt
ccagacgtggtgatcggccagatcgaggcgctggcggcgaccgtccatgccgaagccccg
gcactgtcggtcgtcggcgtcggtgtcggtgcgccgggaccgcttgatccgctggccggc
atcgccgtcggcccgccgacactcaccggctggctggatgtaccgcttgccgacatcctc
gagcggcggctcggcctgccggtccgtctggagaacgacgccaatgccgcggcgctcggc
gaatggcgcttcggcgccggccatggcgctcgctcgctggtctttgtcacggtgtcgacc
ggcatcggcggcggtgtcgtcgtcgatgggcgcatcctgcatggccgccgtggccttgcc
gccgagatcggtcacatgaccatcaccaatgagggcgagcgttgcgtgtgcggcgtcatc
ggctgcttcgaggccatcgcttcgggaaccgcgctcggccgccgcgccaccgccgccacg
gcggccggcgacggctctgccttgcggcgcctgtcagcggatgcggaggtgaccggccgc
cacgtcgtcgaggcggcacggctgcgcgacgatcttgcctcggccttgctggacgaggaa
gcccgctggctgggcgtcggcttcaccaacctgttacatctctattcgcccgatgtgctg
gtcgtcggcggcggcatcgccaatgggctcgacctgatggcgccgaccatcgaggcaacc
atcaggcagcgggccatgcgcgcctatcgcgacgtaccggtcgttccagcacagctcggc
cgccatgctgggctcgtcggcgccgccagccttgtgctgttcgacgacgagggcacgatt
gccgcccgcatgcctgtcggcccaagcacatatccggacacaccactgagcaagatcggc
accgtctga

DBGET integrated database retrieval system