KEGG   Mesorhizobium ciceri: Mesci_5319Help
Entry
Mesci_5319        CDS       T01401                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mci  Mesorhizobium ciceri
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mesci_5319
   01230 Biosynthesis of amino acids
    Mesci_5319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mesci_5319
   00051 Fructose and mannose metabolism
    Mesci_5319
   00562 Inositol phosphate metabolism
    Mesci_5319
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mesci_5319
Enzymes [BR:mci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mesci_5319
Exosome [BR:mci04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mesci_5319
  Exosomal proteins of bladder cancer cells
   Mesci_5319
  Exosomal proteins of melanoma cells
   Mesci_5319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5484242..5485009)
Genome map
AA seq 255 aa AA seqDB search
MAPYWVGTSWKMNKTLAEALLFADALAAFVPGFDQAIQPFVIPPFTAARQVKAALANTRV
KVGAQNMHWADAGAWTGEISPVMLKDCGLDVIELGHSERREHFGETDATVGLKTAAAVRH
GFVPLICVGETLDERESGRAEAVLTAQVLGALQELSGDQPKAEILFAYEPVWAIGEKGIP
ASADYADKQQALIKQVAADRLPAAPPVLYGGSVNPGNAAELIGQPHIDGLFIGRSAWQAE
GYIDILKKASAAIAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccccatattgggtcggcacgagctggaagatgaacaagacgcttgccgaggcgttg
ctgttcgccgatgcgttggccgccttcgtgcctggtttcgatcaggcgatacagcctttc
gtcattccgccgttcaccgccgcgcgccaggtcaaggcggcactggccaacacccgcgtg
aaggtaggtgcccagaacatgcattgggccgatgccggtgcctggacgggagagatttcg
ccagtgatgttgaaagactgcgggctggatgtaatcgaactcggccatagcgagcgccgc
gagcatttcggcgagacggatgcgactgtcggactgaaaacggcggctgctgtcaggcac
ggttttgtgccactgatctgcgtcggcgagacgctggacgagcgtgaatcaggccgcgcc
gaggcggtgctgacggcacaggttctcggtgcgctgcaggagctgagcggcgatcaaccg
aaggcggaaatcctctttgcctacgagcctgtctgggcgatcggggagaagggcattccc
gcaagcgccgactatgccgacaagcagcaagcgctgatcaagcaggtagccgctgaccgg
ctgccggctgccccgcctgtgctttacggcggcagcgtcaaccccggcaacgcggccgaa
cttatcggccagccgcatattgatggcctgttcatcggccgctcggcgtggcaagcggaa
ggctatatcgacattctgaaaaaggcgtcggccgccatcgcgcgctaa

DBGET integrated database retrieval system