KEGG   Mesorhizobium ciceri: Mesci_5319Help
Entry
Mesci_5319        CDS       T01401                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
mci  Mesorhizobium ciceri
Brite
Enzymes [BR:mci01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Mesci_5319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(5484242..5485009)
Genome map
AA seq 255 aa AA seqDB search
MAPYWVGTSWKMNKTLAEALLFADALAAFVPGFDQAIQPFVIPPFTAARQVKAALANTRV
KVGAQNMHWADAGAWTGEISPVMLKDCGLDVIELGHSERREHFGETDATVGLKTAAAVRH
GFVPLICVGETLDERESGRAEAVLTAQVLGALQELSGDQPKAEILFAYEPVWAIGEKGIP
ASADYADKQQALIKQVAADRLPAAPPVLYGGSVNPGNAAELIGQPHIDGLFIGRSAWQAE
GYIDILKKASAAIAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggccccatattgggtcggcacgagctggaagatgaacaagacgcttgccgaggcgttg
ctgttcgccgatgcgttggccgccttcgtgcctggtttcgatcaggcgatacagcctttc
gtcattccgccgttcaccgccgcgcgccaggtcaaggcggcactggccaacacccgcgtg
aaggtaggtgcccagaacatgcattgggccgatgccggtgcctggacgggagagatttcg
ccagtgatgttgaaagactgcgggctggatgtaatcgaactcggccatagcgagcgccgc
gagcatttcggcgagacggatgcgactgtcggactgaaaacggcggctgctgtcaggcac
ggttttgtgccactgatctgcgtcggcgagacgctggacgagcgtgaatcaggccgcgcc
gaggcggtgctgacggcacaggttctcggtgcgctgcaggagctgagcggcgatcaaccg
aaggcggaaatcctctttgcctacgagcctgtctgggcgatcggggagaagggcattccc
gcaagcgccgactatgccgacaagcagcaagcgctgatcaagcaggtagccgctgaccgg
ctgccggctgccccgcctgtgctttacggcggcagcgtcaaccccggcaacgcggccgaa
cttatcggccagccgcatattgatggcctgttcatcggccgctcggcgtggcaagcggaa
ggctatatcgacattctgaaaaaggcgtcggccgccatcgcgcgctaa

DBGET integrated database retrieval system