KEGG   Mesorhizobium ciceri: Mesci_5441Help
Entry
Mesci_5441        CDS       T01401                                 

Definition
PAS sensor protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mci  Mesorhizobium ciceri
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mci00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mesci_5441
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mesci_5441
Enzymes [BR:mci01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mesci_5441
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mesci_5441
Two-component system [BR:mci02022]
 CheA family
  CheA-CheYBV
   Mesci_5441
Bacterial motility proteins [BR:mci02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mesci_5441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5622786..5625896)
Genome map
AA seq 1036 aa AA seqDB search
MTARSTRFPIVGIGASAGGIPAMEGLFKGVTSQPGMAFIIITHLSPKRESLLHEVVSRYT
EMPVVVAEDGIAVVPDHVYVMPQNVTLAIANGVLRLRRPNGLTQERKPVDIFFSALAEDQ
GEYAVGVILSGGDSDGTLGAKAIKERGGLTVAQAHDGYGPRNPDMPQSAIASGLVDVAVP
AEEIGAKLEAFARGFDTLKGLAEEDGDHTADIDKVREQIYAILRSHSGHDFSGYKTKTFL
RRVKRRMQIAQVHSISAYIDWLKKDAREVMNLFRDLLINVTNFFRDPDAFELLERKIIPQ
LFEGKTASDTVRVWVPGCATGEEVFSIGILLREHMETLTVVPRVQIFATDIDEPALAVAR
AARYPEALLQGLSPERRQRFFNGDGESYVISNEIRELCIFSPHSVIRDPPFSRMDLVSCR
NLLIYFGPSIQSRVIPVFHYALKPGGYLFLGTSESVGQHDNLFATVDKKHRLFQAREHAS
PHIRLPALIGESRSGVFPSESAGLRKGAAGYPLRQAVEAQVLERFAPPHVLVNAEGDVVY
YSARTGRYLEAPQGIPSRQLLTMARRGLRLDLRAALREATTTRRTVVRENLIVEEDDERV
QPIKLTIEPLTERGNGEPLYLVLFEPSGPTQARSEEDGGGRDSDSTADLERELRDTRERL
QSTIEEYETALEEVKSSNEELVSVNEEAQSTNEELEASKEEMQSLNEELNTINAELTAKI
EELDHVNGDLRNLFESTDIATIFLDRSLVVRTFTPAASSFFSLRPSDVGRPLTDLSSQLD
YPELKQHIDKVFETGEILNHHLARDARGLFHMVRINPYRDKGNRIQGVVVTLVDVTTLAQ
AEEHQQVLISELNHRVKNMLAVIASIASRTRESSDTKEEFADALIGRLHAMSRAYGLLTR
ERWKEASVREMLQQELEPFGIDRIELDGKDVKLGPQQGLSLSMAIHELATNAAKYGALSK
TDGKVSVQWSIDDDSFTFGWREKDGPPVKAPLDNGFGLTLLQGEIDYRLGGHVETAFHKD
GLSVQIAFPANHKEAP
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcccgatcgactagatttcccatcgttggcatcggcgcgtccgcgggtggcatt
cccgcgatggaaggcttgttcaaaggcgttaccagccagcccggcatggcgttcatcatc
atcacgcatctcagcccgaagcgagaaagtctgttgcatgaagttgtcagccgctacacc
gagatgcctgtcgttgtggccgaagatggcatagctgttgtacctgaccacgtctacgtg
atgccacaaaacgtcactctggcgatcgccaacggtgtgctgcgcctgcggcggcccaac
gggcttacccaagagcgcaaacccgtcgacattttctttagtgcgctcgctgaagaccag
ggcgaatatgccgtgggcgtcattctgtcgggcggtgattccgatggaacgctgggcgcc
aaggcgatcaaggagcggggtggcctcactgtcgcgcaagcgcacgacggctacgggccg
cgcaatcccgacatgccacagagcgctattgccagcgggctcgtcgacgtcgctgtgccc
gccgaggagatcggggcgaagctggaggctttcgcccgcggcttcgacacgctgaaaggg
ctggcggaagaagatggcgaccatacggccgacatcgataaggtgcgagaacagatatac
gccattctgcgcagccactccggccacgacttctcgggctacaagaccaagacgttcctg
cgccgcgtgaagcgacgcatgcagatcgcccaggtccattccatcagcgcctatatagac
tggctgaagaaagatgctcgcgaggtgatgaacctttttcgcgatctgctgatcaatgtc
accaacttctttcgcgaccccgatgccttcgagttgctcgagcgaaagatcataccgcag
ttgttcgaaggcaagaccgccagtgacaccgtcagggtctgggttcccggatgcgccacc
ggcgaggaggtgttctccatcggcatcctgctgcgcgaacacatggagacgcttacggtc
gttccgcgcgtccagatatttgccaccgacatagacgagcctgcgctggcggtggcccgg
gcggcacgctatcccgaagccttgctgcaagggctttcacccgaacgccgacagcggttc
ttcaacggcgacggagagagctatgtcattagcaacgagatacgggaactgtgcatcttc
tcgccgcacagcgtcattcgcgatccgcctttctcgcgcatggatctggtctcctgccgc
aatctgctgatctatttcggcccgagcatccagagccgtgtcatccctgtctttcactat
gcattgaaacccggcggttacctgttcctcggcacctccgaaagcgttgggcagcacgac
aatctgtttgccactgtcgacaagaaacatcgtctcttccaggcgcgcgagcatgcctcg
ccgcatatcaggctgcccgccttgatcggtgagagccgttccggcgtctttccctctgaa
agcgccggcttaaggaagggagccgccggttatccgctgcgccaggctgtcgaggcgcag
gtactggagcgcttcgctccgccgcatgtcctggtcaacgctgagggcgatgtcgtctat
tattcggccaggaccggcagatatctcgaagcgccgcaagggattcccagccggcagttg
ctgacgatggctaggcgtgggctgcgactggacctccgcgccgcgttgcgggaagcgacg
acgacgcgccgcacagtggtgcgggaaaacctcatcgtagaggaagacgacgaacgggtc
cagccgatcaagctcacgatcgaaccgctcaccgaacgtggcaatggcgagccgctttat
ctcgtcctgttcgaaccgtcggggccgacccaggcccgctcagaggaagacggcggcggc
cgtgacagtgacagcaccgccgatctcgagcgggagctgcgcgacaccagggagcgcctg
caatcgacgatcgaggaatacgagaccgcgctggaggaggtcaaatcgtcgaacgaggaa
ctcgtctccgtcaatgaggaggcgcagtccaccaatgaggaactcgaagcctcgaaggag
gagatgcagtcgctcaacgaggagctcaacacgatcaacgccgagttgacggccaagata
gaggagctcgaccacgtcaacggcgatctgcgcaacctgttcgaaagcaccgacatcgcg
accattttcctcgaccgcagccttgtggtccgtaccttcacgccggcggcgtcatccttc
ttcagcctgcgtccctccgatgtcggccggccgctgacggatctgtctagccagctcgac
taccccgagttgaagcagcacatcgacaaggtcttcgagacaggcgagatcctgaatcac
catctggcacgcgatgccaggggcctgttccacatggtccgcatcaatccctatcgcgac
aagggcaacaggatccagggcgtggtggtgacacttgtcgatgtcaccactctggcacag
gcggaagagcatcagcaggtgctcatctcggaactcaaccatagggtcaagaacatgctt
gcggtgatcgccagcattgcaagccgcacgcgggaaagttctgatacgaaggaggagttc
gcggatgcgctgatcggccgcctgcatgccatgtcgcgggcctacggcctgctgacccgg
gagagatggaaggaagcctcggtcagggaaatgctccagcaggagctcgaaccattcggc
atcgatcggatcgaactcgatggcaaggatgtcaaactaggtccgcaacaggggctctcc
ctgagtatggccatccatgaactggccaccaacgcggccaagtatggcgctttgtcaaaa
accgacggcaaggtcagtgtgcaatggtcgatcgacgatgacagtttcacatttggctgg
cgagaaaaggacggccctcctgtcaaggcgccgttggacaatggctttgggctgaccttg
ttgcagggtgaaattgattacaggctgggcggccatgtcgagaccgcgttccacaaagac
ggcctcagcgtccagattgcgtttccggcaaaccacaaggaggcgccgtga

DBGET integrated database retrieval system