KEGG   Mesorhizobium ciceri: Mesci_6001Help
Entry
Mesci_6001        CDS       T01401                                 

Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mci  Mesorhizobium ciceri
Pathway
mci00071  Fatty acid degradation
mci00280  Valine, leucine and isoleucine degradation
mci00281  Geraniol degradation
mci00310  Lysine degradation
mci00362  Benzoate degradation
mci00380  Tryptophan metabolism
mci00410  beta-Alanine metabolism
mci00640  Propanoate metabolism
mci00650  Butanoate metabolism
mci00903  Limonene and pinene degradation
mci00930  Caprolactam degradation
mci01040  Biosynthesis of unsaturated fatty acids
mci01100  Metabolic pathways
mci01110  Biosynthesis of secondary metabolites
mci01120  Microbial metabolism in diverse environments
mci01130  Biosynthesis of antibiotics
mci01200  Carbon metabolism
mci01212  Fatty acid metabolism
Module
mci_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mci00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mesci_6001
   00650 Butanoate metabolism
    Mesci_6001
  Lipid metabolism
   00071 Fatty acid degradation
    Mesci_6001
   01040 Biosynthesis of unsaturated fatty acids
    Mesci_6001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mesci_6001
   00310 Lysine degradation
    Mesci_6001
   00380 Tryptophan metabolism
    Mesci_6001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mesci_6001
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mesci_6001
   00281 Geraniol degradation
    Mesci_6001
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mesci_6001
   00930 Caprolactam degradation
    Mesci_6001
Enzymes [BR:mci01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mesci_6001
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mesci_6001
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mesci_6001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO F420_oxidored NAD_binding_2 Sacchrp_dh_NADP UDPG_MGDP_dh_N ApbA 2-Hacid_dh_C NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 10121503
NCBI-ProteinID: YP_004145058
UniProt: E8TKU4
Position
complement(6217302..6219521)
Genome map
AA seq 739 aa AA seqDB search
MSYTNFALDTDADGIALVTWDMPGRSMNVFTEEAMRELNAIVDKVAGDAAIKGAVITSGK
DTFSGGADISLLQKMLTTFAAEKGKDAEKATKALFDNAGMMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVAADSDKVKMALPEVKIGIFPGAGGTQRVPRLTDQQQALQMLT
SGQTLSPQKAKSMGLIHEIAEPTRLVETAKAMIRNGLKPVAPWDEKGFKLPGGQIYSPAG
FNLWPPAIAILRRETYGNYPAAAAILKCVYEGLLVPFDTALRIEQRYFTEIMQTREAAAM
IRSLFVSLQELNKGARRPAGVPETKFKKIGILGAGFMGAGIAYVTAKAGIPVVLLDRDLE
SAAKGKAHSDSLVSDQVKKGRAKPEDKDKLLSLITPTADYADLAGCDLVVEAVFEDSGVK
KSATEQAEAVLKPSAIFASNTSTIPISSLAKNSARPKNFIGIHFFSPVDKMMLVEIILGK
KTGDKALATAIDFVRAIKKTPIVVNDTRGFYVNRCVLRYMSEAYKMLIEGVPAPMIENAA
KAAGMPVGPLALTDETAIDLAQKIMKQTIRDLGDKAVDPKQMALINTMVDDHGRFGRKNG
KGFYDYPAKPAKKKLWPGLKELYPQLAPEKVDYEELQQRLLVTIALEAARVMEEGIVTDP
READVGSILAFGFAPYTGGALSYIDGIGAKAFVKIARNLQKKYGAEFKAPKLLLDMAEKG
ESFYQRFDPYAKGETRKAA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgagctacaccaatttcgccctcgacaccgacgccgacggcattgcgctggtcacctgg
gacatgcccggccgttcgatgaacgtcttcaccgaagaggcgatgcgggaattgaacgcc
attgtcgacaaggtggctggtgacgccgccatcaagggcgccgtgatcacctccggcaag
gataccttctccggcggtgcagatatctctttgctgcagaagatgctgacgaccttcgcc
gcggaaaagggcaaggacgccgaaaaggcgaccaaggcgctgttcgacaatgccggcatg
atgaccggcctgttccgcaagctggaaacttgcggaaagccgtgggtgtcggcgatcaac
ggcacctgcatgggcggcgccttcgaattgtcgctcgcctgccacggccgtgtcgccgcc
gatagcgacaaggtgaagatggcgcttcccgaggtgaagatcggcatcttcccgggcgcc
ggcggcacccagcgcgtgccgcggctgaccgatcagcagcaggcgttgcagatgctgacc
tccggccagacgctgtcgccgcagaaggccaagtcgatgggcctgatccatgagatcgcc
gagccgacaaggttggtcgagaccgccaaggcgatgatcaggaatggcctgaagccggtg
gcgccatgggacgagaaaggtttcaagctgcccggcggccagatctattcgccggccggt
ttcaatctgtggccgccggcgatcgccatcctgcgccgcgagacttatggtaactatccg
gccgccgccgcgatcctcaaatgcgtctatgaaggcctgctggtgccattcgacaccgcc
ttgcgcatcgagcagcgctatttcaccgagatcatgcagaccagggaagcggcggcgatg
atccgctcgttgtttgtgtcgctgcaggaactgaacaagggcgcccgccgcccggccggc
gtgcccgaaaccaagttcaagaagatcggcattctcggcgccggcttcatgggcgccggc
atcgcctatgtcaccgccaaggccggcatcccggtggtgctgctcgaccgtgatctggag
tcggccgccaagggcaaggcgcattccgacagcctggtctcggatcaggtcaagaagggc
cgcgccaagccggaggacaaggacaaactgctgtcgctgatcacgccgacggcggactac
gccgaccttgccggctgcgatctggtggtcgaggcggtgttcgaggattcgggcgtcaag
aagagcgccaccgaacaggcggaagccgtgttgaagccatcggcgatcttcgcgtcgaac
acctccaccatcccgatctcgtcgctggccaagaattcggcgcggccgaagaatttcatc
ggcatccatttcttctcgccggtcgacaagatgatgctggtcgagatcattttgggcaag
aagaccggcgacaaggcgctggccaccgcgatcgacttcgttcgcgccatcaagaagacg
ccgatcgtcgtcaacgacacgcgcggcttctacgtcaaccgctgcgtgctgcgctacatg
tcggaagcctacaagatgctgatcgaaggtgtgcccgcgccgatgatcgagaacgcggcg
aaggcagccggcatgccggtcggccccctggcgctgaccgacgaaacggccatcgacctt
gcccagaagatcatgaagcagaccatcagggatttgggcgacaaggcggtcgatcccaag
cagatggcgctgatcaacaccatggtcgacgatcacggccgcttcggccgcaagaacggc
aagggtttttacgattatccggccaagcccgccaagaagaagctgtggccgggcctcaag
gagctctatccgcagcttgcgcccgagaaggtcgattatgaggagctgcagcagcggctt
ctggtcaccatcgcgctggaagcggcacgggtgatggaagaaggcatcgtcaccgacccg
cgcgaggccgatgtcggctcgatcctcgctttcggcttcgctccctataccggcggtgcg
ctgtcctacatcgacggcatcggcgccaaggcgttcgtcaagatcgccagaaacctgcag
aagaaatacggcgccgagttcaaggcgcccaagctgctgctcgacatggccgagaagggt
gagagcttctatcagcgcttcgatccctatgcgaaaggcgagaccaggaaagcggcgtga

DBGET integrated database retrieval system