KEGG   Mesorhizobium ciceri: Mesci_6036Help
Entry
Mesci_6036        CDS       T01401                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mci  Mesorhizobium ciceri
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mci00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Mesci_6036
Enzymes [BR:mci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Mesci_6036
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Mesci_6036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6261464..6262354
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVRRGLQLVLEGATIARVEARRPDLRFPFPEKFAQRLAGKTITALGRRAKYL
TMDLEGGPALICHLGMSGSFRIETADGSDMPGIFRHDRSKSSNHDHVVFHVVSPAGTRSR
VIFNDPRRFGFMLFAEGLPDVHPMLAGLGVEPTGNTLDGALLSSLMKGRRSPLKAALLDQ
RLIAGLGNIYVSEALWRAGLSPLREAGTIARPGKKAQAQSEHLAQAIRSVISDAIAAGGS
SLRDYMQTDGSLGYFQHAFAVYDREGEACSKPSCGGHIERVVQSGRSTFYCRTCQR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttaccggaggtcgaaaccgtccggcgcggacttcagctggttctggaaggc
gccaccatcgcccgcgtcgaggcgcgccgaccggatctgcgctttccatttcccgagaaa
ttcgcgcagcgactggccggcaagacgatcacggcactcggccgccgggccaagtatctg
acgatggacctggaaggcggccccgcgctgatctgccatctcggcatgtcgggctcattc
cgcatcgagacggccgatggcagcgacatgcccggcatcttccggcacgaccgctcgaag
agctccaatcacgaccacgtcgtcttccatgtcgtgtctccggccggtacccgatcgcgc
gtgatcttcaatgatccgcgccgcttcggcttcatgttgtttgcggaaggactgccggac
gttcatccgatgctggctggacttggcgtcgagcctacgggcaacacattggacggtgcg
ctgctttcctcattgatgaaggggcggagatcaccgctgaaggcagcgcttctcgaccag
aggctgatcgccgggctcggcaatatctatgtgtcggaggcgttgtggcgtgcgggcctg
tcgccgctgcgcgaggcgggcacgatcgccaggcccggaaagaaagcccaggcccaaagc
gaacacctcgcgcaagccattcgttcggtgatatcggatgcgatcgcagccggcggttcc
tcactgcgggactatatgcagaccgatgggtcgctgggctatttccaacacgccttcgcc
gtctacgaccgcgaaggcgaggcctgctccaagcccagttgcggcggccacatcgagcgt
gtcgtgcagagcggccgatcgaccttttattgccggacatgtcagcgatga

DBGET integrated database retrieval system