KEGG   Methanosaeta concilii: MCON_0169Help
Entry
MCON_0169         CDS       T01468                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCON_0169 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_0169 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MCON_0169 (thrC)
Enzymes [BR:mcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MCON_0169 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(154991..156340)
Genome map
AA seq 449 aa AA seqDB search
MSLIKFFSTNGHLDRVDFKGALLAGQAPDKGLYMPEMFPSLSPETIRNFPQMSYHQIAYQ
VIKPYLGDLVEESALEDMLKDAYSYEVPLERVYDGKYLLRLDRGPTCSFKDFAARLMGRL
MQYFLKEEGRSMIILTATSGDTGSAVAHAFYGLENIKVIVLFPEREVTERQRRQMTTLGE
NIYPLAVTGKFDDCQALVKQAFVDPELKGLELSSANSINVGRLLPQAVYYFYAHSRVAPG
GEEVVFSVPSGNFGDLMGGLIALKMGLPVKKFVAATNENDEFPRFMQTGVYEPIRPSKNC
ISNAMNVGHPSNLARLFSLYGGQMDETGQVARQPDLSAMREEIYAVSISDEETRQTIREA
YSQYKVLLEPHGAVGWAGLVRYLDEFGDWSPAVSLETADPAKFPDEIVRLTGVNPSLPPA
MASLDEKEEHYLEMDGSYASLKNYLKGFF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaatcaagttcttcagcaccaacggccacctggatagggtggactttaaaggg
gctctcctggctggccaggccccggataaggggctctatatgcccgagatgttcccttct
ctctccccggaaaccatccggaattttcctcagatgagctatcatcagatcgcataccag
gtcatcaagccatatcttggcgacctggtggaagaatcggctctagaggatatgctaaaa
gacgcctacagctatgaggttcccctggagcgggtctatgacggcaagtacctgctgcgg
ctggatcggggtcctacctgctcattcaaggactttgccgccaggctgatgggcaggctg
atgcagtacttcctcaaagaggagggaaggagcatgattattttaactgccacttctggg
gacaccggctctgcggtagcgcatgcattttatggcctggagaatatcaaggtgatagtg
ctattcccggagagggaggttacggaaaggcagcgccggcagatgaccacacttggcgag
aacatctatcctctggccgtaaccggcaagttcgatgactgtcaggccctggtcaagcag
gcatttgtcgatccggagctcaagggactcgagctctcctcagccaactccataaatgtc
ggccggctgctgccccaggcggtctattacttctatgctcattctcgggttgcacccgga
ggagaggaggtggtcttctctgttcccagcggaaacttcggcgacctgatgggcggtctt
atcgctctgaagatggggcttcctgtgaaaaagttcgtggcggccaccaatgagaacgac
gagtttcctcgcttcatgcagaccggcgtctatgagccaatccggccgagcaagaactgc
atctccaatgccatgaacgtcggccatcccagtaaccttgcccggctcttctccctttac
ggcggccagatggatgagaccggacaggtagccaggcagccggacctctccgccatgcgc
gaggagatctatgccgtatctatcagcgatgaggagacccgccagaccatcagagaggct
tactctcagtacaaggtcctcctcgagccccacggtgcagttggatgggcggggctggtg
aggtatctggatgaattcggagactggagccccgccgtctccctggagacggcagatcct
gccaagttcccggatgagattgtgcgccttacaggggtgaatccctctcttcctccagcc
atggccagtcttgatgagaaggaggagcactacctggagatggatggcagctacgcttca
ctgaagaattatctgaagggctttttctga

DBGET integrated database retrieval system