KEGG   Methanosaeta concilii: MCON_0555Help
Entry
MCON_0555         CDS       T01468                                 

Gene name
mptN
Definition
tetrahydromethanopterin:alpha-L-glutamate ligase (EC:6.3.2.-)
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mcj  Methanosaeta concilii
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCON_0555 (mptN)
Enzymes [BR:mcj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MCON_0555 (mptN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(489100..489999)
Genome map
AA seq 299 aa AA seqDB search
MKVGIVVSDRDDWTAQALMASFSRRQMDATFLDFSELKSGIGKRLDFSCGDVNLLDLDAL
VVRDLGRRGAVDVSFRFEALTALVELGISVINPPEAISSAANKYATSRRLHGASVPTPRT
VATTSPKIAEEALYSFKTAVSKPLFGYKGKDIILLKSSKQADIESLREIVERRGMVYLQE
FINVTSGSARDIRAFVVDGRLQGAIYRNAPPGEWISNLARGGRPTPCPKTRELEDLAVRS
ARAVGAIYCGVDLLESKDGLTTIEVNGTPSGKGIYDALGIDVTEAIAEHVCSNLDHRKG
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttggaatcgtggtctccgaccgggacgactggacggctcaggctttaatggcc
tcattttcccggcggcagatggatgcgacattccttgatttctcagagcttaaaagcgga
atcggtaaaaggctggattttagttgcggcgacgttaacctcctggacctggacgccctg
gtggtccgcgacctggggaggcggggggcggtcgatgtctcctttcgcttcgaggccctg
actgccctcgtggagttgggaatttcagtcatcaatccccccgaagccatctccagtgcg
gcaaacaagtatgctacatccaggaggctgcatggcgcttcggtgcccacaccgaggact
gtggccaccaccagcccaaagattgccgaggaggccctttattcctttaaaacggcggta
tccaagccgcttttcggctataaaggaaaggatatcatcctcttaaagagcagcaagcag
gcagacatcgagagtctgagggagatagtggagaggagggggatggtctacctgcaggag
tttatcaatgtcacctccggctcagcgcgcgatatccgggctttcgtggtggacggcaga
ttgcagggagccatctatcgcaatgctccaccgggagaatggatcagcaatctggcgcga
ggtggccggcccaccccctgtccgaaaacccgtgagctggaggacctggcggtgagatct
gcccgcgccgttggtgccatatattgcggcgtcgacctcctggagagcaaggatggcctg
acgacaatagaggtgaacgggaccccctcaggcaaagggatctatgatgccctgggaata
gatgtcacagaagcgatagcagagcatgtctgctccaatctggatcacagaaagggatga

DBGET integrated database retrieval system