KEGG   Methanosaeta concilii: MCON_0561Help
Entry
MCON_0561         CDS       T01468                                 

Gene name
acsA
Definition
(RefSeq) acetyl-coenzyme A synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_0561 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_0561 (acsA)
   00620 Pyruvate metabolism
    MCON_0561 (acsA)
   00640 Propanoate metabolism
    MCON_0561 (acsA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_0561 (acsA)
   00680 Methane metabolism
    MCON_0561 (acsA)
Enzymes [BR:mcj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCON_0561 (acsA)
Lipid biosynthesis proteins [BR:mcj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCON_0561 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(497626..499644)
Genome map
AA seq 672 aa AA seqDB search
MLKLAGKEDKKLKTTVFQDETRIFNPPKELVEKSIVMQWMKKKGFKTEKEMRAWCSSDEH
YLEFWDEMAKTYVDWHKTYTKVMDDSEMPYFHWFTGGEINITYNAVDRHAKGAKKDKVAY
IWIPEPTDQPVQKITYGDLYKEVNKFANGLKSLGLKKGDRVSIYMPMIPQLPIAMLACAK
LGVIHSVVFSGFSSKGLMDRAADCGSRAIITVDGFYRRGKPVPLKPNADEAAGGAPSVEK
IIVYKRAGVDVSMKEGRDVWWHDLVKGQSEECEPVWVDPEHRLYILYTSGTTGKPKGIEH
ATGGNAVGPAQTLHWVFDLKDDDVWWCTADIGWVTGHSYIVYAPLILGMTSLMYEGAADY
PDFGRWWKNIQDHKVTVLYTAPTAVRMFMKQGAEWPDKYDLSSLRLLGSVGEPINPEAWM
WYREHIGRGELQIMDTWWQTETGTFLNSPLPITPLKPGSCTFPLPGYDISILDEEGNEVP
LGSGGNIVALKPYPSMLRAFWGDKERFMKEYWQFYWDVPGRRGVYLAGDKAQRDKDGYFF
IQGRIDDVLSVAGHRIANAEVESALVAHPKIAEAAVVGKPDEVKGESIVAFVILRVGNEP
SPELAKDAIAFVRKTLGPVAAPTEVHFVNDLPKTRSGKIMRRVVKARALGNPVGDISTLM
NPEAVDGIPKIV
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgttgaaattggctggcaaagaagacaagaagttgaagacgacagtatttcaggacgag
accagaatctttaatccgccaaaagagttggtagaaaagtcaatcgtgatgcagtggatg
aagaagaaagggttcaagactgagaaggagatgcgtgcttggtgctcctctgatgagcat
tacctcgagttctgggacgagatggcaaagacgtacgttgactggcacaagacctatact
aaggtgatggacgactcggagatgccctacttccactggttcactggaggtgaaatcaac
atcacatacaacgccgtggacaggcacgccaagggcgcaaagaaggacaaagttgcatac
atatggataccagagccgacagaccagccagtccagaagatcacctacggcgacctctat
aaggaggtcaataagttcgcaaacggcctcaagagcctcggcttgaagaagggggatcgg
gtcagcatctacatgcccatgataccccagcttcccatcgccatgctcgcctgcgccaag
ctcggcgtcatccacagcgtggttttctccggattcagctccaaaggcctgatggacagg
gctgctgactgcggttccagagccatcatcaccgtggatggattctacaggcgcggaaag
ccggtgcctctgaagccgaacgccgacgaggcagctggcggcgctccgtcagttgagaag
attatcgtctacaagcgtgcgggcgttgacgtttccatgaaagagggcagggacgtctgg
tggcatgatctggtcaagggccagtccgaagagtgtgagccggtatgggttgacccggag
cacaggctgtatatcctctacacctccggcacaaccggcaagcccaagggtatcgagcac
gcaacgggcggaaacgccgtcggaccggctcagacgcttcactgggtcttcgacttgaag
gacgacgatgtctggtggtgtaccgccgatattggatgggtcaccggtcactcctacatc
gtctacgctccgctcattctgggcatgaccagcctcatgtacgagggcgctgcagactat
ccagacttcggtaggtggtggaagaacatccaggaccacaaggtcaccgtcctttacact
gcccccacggcggtaaggatgttcatgaagcagggcgcagaatggcctgataagtacgac
ctctcaagcctgaggctactgggatccgtcggcgagccgatcaatccggaggcctggatg
tggtatcgtgagcacattggacgaggcgagctccagatcatggacacctggtggcagacc
gagaccggaaccttcctcaactctccgctgcccatcacgccactgaagcccggatcgtgc
acattcccgctccccggatatgacatatccatcctggatgaggaagggaatgaggttcct
ctgggatccggaggcaacatagtggcattgaagccctatccttcgatgctcagggcgttc
tggggcgacaaagagaggttcatgaaggagtactggcagttctactgggatgttcccggc
cgccgcggcgtctatctcgctggagacaaggcgcagagggacaaggacggctacttcttc
atccagggcagaatcgatgatgttctcagcgtcgcaggccacaggatagccaacgccgag
gtcgagtctgccctggtggctcaccccaagatagccgaggcggcagtagttggaaagccc
gacgaggttaagggcgagtcgatcgtcgccttcgtcattctgagggtcggaaatgaaccg
tcccctgagctggcaaaggatgcgatcgctttcgtcaggaagacccttgggccggtggct
gcgcccacggaggtccacttcgtcaacgacctcccgaagacgaggagcggcaagataatg
cgccgtgtcgtcaaggcgagggcccttggaaacccggttggggacatatcgaccctgatg
aatccagaagcagtggatgggatccccaagatcgtctga

DBGET integrated database retrieval system