KEGG   Methanosaeta concilii: MCON_0583Help
Entry
MCON_0583         CDS       T01468                                 

Definition
(RefSeq) AMP phosphorylase (EC:2.4.-.-)
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
mcj  Methanosaeta concilii
Brite
Enzymes [BR:mcj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     MCON_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(517923..519437)
Genome map
AA seq 504 aa AA seqDB search
MLLVRPFDIEIGQHKVMLNIVDARERGLNPGDRVRVRAKGAATTALLDTTTQMVKPGEIG
IFTEALKDLNNPVDVDILPAPRPASICHIKSLMDNEKLSEDQIRTIVQDIVDNNLSDIEL
AAYVTASYIHNMPSEEVVWLTKAMIETGERIHFDTHPVMDKHSIGGVPGNKVSLLIVPIV
AAAGLLIPKTSSRAITGAGGTADLMEVLAPVEFSAAEIKEITEKVGGVIVWGGATNIAPA
DDKLIKAEYALSIDPYSQMLASIMAKKGAVGADAVVVDMPVGPGTKLPTADDGRTLAKDL
IDLGDKLGIRVECAMTFGGSPVGRTIGPALEVREALTLLENKPGPNSLREKSLSLAGILL
EMGGVAGRGEGYAAAEEILSSGKAHAKLMEIIAAQGGNPNVKSEDIVIGENCEEILAPAG
GYVVAFYNKRLVELARMAGAPSDQKAGVIIHKKMGERVKKGEPLITICSSSDWELDSAVR
DAKRSMPIVVEGMLLERYPRITEL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctgctagttcgaccctttgacatagagataggtcagcataaagtcatgctcaatatc
gttgatgcccgggagaggggcttgaatcctggagaccgggtccgggtgagggccaagggg
gctgcaaccaccgccctgcttgataccaccacccagatggtcaagcctggggagatcggt
atcttcactgaggctcttaaggatctcaataatccggtggatgtggatatcctgcctgca
ccgaggcctgcttccatctgtcatatcaaaagcttgatggataacgagaagctgagcgag
gatcagatccgaaccattgtgcaggatatcgtagacaacaacctcagcgacattgagctt
gctgcttatgtcaccgcttcctacattcataacatgccctctgaggaggtggtctggctg
accaaagcgatgatcgagactggtgagcggattcacttcgacacccatccggtcatggac
aagcacagcattggcggcgttcccgggaacaaagtatcccttctcattgtgcccatagtg
gcagccgcaggccttctcattcccaagaccagctctcgggccataaccggggcgggcggt
acagccgacctgatggaggtcttggccccggtggagttcagtgcggcagagatcaaggag
ataacagagaaggtgggcggagtcatagtctggggcggagccaccaatatcgcccctgca
gatgataagctgattaaagcggagtatgcattatccatagacccctacagccagatgctg
gcctccatcatggccaagaaaggggctgtaggcgctgacgcagtggtagtggatatgcct
gtagggccgggcacaaagctgcccacggcagacgacggcaggaccctggccaaggacctg
atagacctgggtgataagctgggaattcgggtggaatgcgccatgacctttggaggctct
cccgtgggcagaaccataggaccggctctggaggtgcgtgaggcgcttacccttctggag
aataagccgggtccaaatagcctgagggagaagagcctctcgttagctggcatactgctg
gagatgggcggagtggcaggacgaggagaaggctacgctgctgcagaagagatcctcagc
agtggaaaggctcatgccaagctgatggaaatcatcgctgcccagggaggcaatcccaat
gtgaagagcgaggatatcgtcatcggcgagaactgcgaggaaattttggctccggcagga
ggatatgtggtggccttctacaataaacgccttgtagagctggctcgcatggctggtgct
ccctcggaccagaaagctggagtcataatccacaagaagatgggtgagagggtgaagaaa
ggcgagcctctgatcaccatctgctcctcatcggactgggagctggatagcgcagtcagg
gatgccaagaggtctatgccaatagtggtagaaggaatgctgctggagagatatccccgc
ataaccgagctttag

DBGET integrated database retrieval system