KEGG   Methanosaeta concilii: MCON_0672Help
Entry
MCON_0672         CDS       T01468                                 

Gene name
chlD
Definition
magnesium-chelatase subunit ChlD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MCON_0672 (chlD)
Enzymes [BR:mcj01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MCON_0672 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
599309..601369
Genome map
AA seq 686 aa AA seqDB search
MHHIKRRTIPFTSIVGQEDMKFALILNAINPRIGGVLIRGDKGTAKSTAVRALADLLEDI
VVVEDCPFNCNPRNVEEMCDLCFDRSQRGQIKEASRKTPVIDLPLGATEDRVVGSLNVER
AIKEGIRALEPGILAAANRGILYIDEVNLLDDHVADVLLDSAAMGVNIVEREGVSVAHPS
KFILVGTMNPEEGELRPQLLDRFGLQVNVVGIEDVDQRMLIAKTAERFDADPEGFSKEQQ
ALQDGLKGKISAAREILGRVTMSDDLLRIIASTCIDLGVKTHRAEIVISRTAKTIAAFEG
RTEANQEDVKKAMELALAHRMRSRPFEPPTLNKDKLEKSMEKQQQDQQQQKQQQQEQQPQ
EQQPKQPPQQKKQEQQPESSDQQEDSDQAQAASPQEQIFEIGAPIDVRQINMPRKRDKIF
RRKTSGRRINTLALQNSGRYLRQRMPKEGKDIAIDATIRAAAPYQKARSGPNAIKVKSED
IREKERARKTSAMLLFVVDGSGSMGAMQRMESAKGAVLSLLMESYQKRDKIGMVAFRGTE
AELILPPSSSVDLALSRLKELPTGGKTPLSAGLSRGLQLLQGEMRKDAETKLMMVLVSDG
RANVGMGGKIKDELMEISERTKQLGVHTIVIDTEVVDSSFMEMRLGYCREIAEMTGGKYY
PISGLSSEALYSIVDEEQKLLLEANT
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgcatcatatcaaaagaaggaccattccttttacatccattgtgggccaggaggacatg
aagtttgcattaatcctgaatgcgatcaatccgcgcataggcggcgtgctgataagaggt
gataaaggaaccgctaaatcaaccgctgtgcgagccctagctgacctccttgaggatatt
gttgtggtagaggactgccctttcaactgcaatcccagaaatgtggaggagatgtgcgac
ctttgctttgacaggagtcagagaggccagattaaagaagcttcacgcaagaccccggtg
atcgaccttcccctgggtgcaacagaggatcgggttgtgggatcgttgaatgtagaaagg
gcaatcaaagagggaatccgggccctggagccgggaattctggctgctgccaacaggggt
atactgtacatcgacgaggtgaatctcctggatgatcacgtggcagacgtgctgctggac
tccgctgccatgggggtgaacatcgtggaacgcgagggcgtgtccgttgcccatccgtct
aagtttatccttgtgggcaccatgaatcccgaggagggagagctgagaccgcagctgctg
gacagattcgggctgcaggtaaatgttgtcggcatcgaggatgtagatcagagaatgctg
attgccaagacggcggaacggtttgatgccgaccctgagggcttctcaaaagagcagcag
gctcttcaggatggtcttaaggggaagatctctgctgccagggagatccttggcagggtg
actatgagcgatgatcttctgagaatcatagcctctacctgcatcgacctgggggtcaag
acccacagggcagagatagtgatctccagaacggccaagaccatagctgcttttgaagga
aggacggaggcgaaccaggaggatgtgaagaaggccatggagctggcgctggctcacagg
atgaggagcaggccctttgagccgccgacccttaacaaagataagctggaaaagtccatg
gaaaagcagcagcaagaccagcagcaacaaaagcaacagcaacaagagcaacagccgcaa
gagcagcaaccaaagcagcctccccagcagaaaaaacaggagcaacagcccgagagttcc
gatcaacaggaggactctgatcaggctcaggctgcatcaccgcaagagcagatcttcgag
atcggagcgccaatagatgtgcggcagatcaatatgcctcgaaagagggacaagattttt
cgcagaaaaaccagtggcaggaggataaacacccttgcactgcaaaactccggaaggtac
ctgagacagaggatgcctaaagagggaaaagatatcgccatcgatgccaccattcgtgct
gcagctccatatcaaaaggccagatcaggacccaatgccattaaagtgaagagcgaggac
attcgagagaaggagcgggcgcgaaagacgtcggccatgctgctctttgtggtagatggc
agtggctcaatgggtgccatgcagaggatggagagcgccaagggagcagtcctctccttg
ctcatggaatcctaccagaaaagggacaagattgggatggtggcctttaggggaacggag
gcagagctgatacttcctccctcttccagcgtggatctggccttaagcaggctaaaggag
ctacccacgggcggcaagacgccgctttctgcaggtctgtcccgcggattgcagctgttg
cagggcgagatgaggaaagatgcagagacaaagctcatgatggtcctcgtatccgatggc
agggccaatgtgggaatgggcggaaagatcaaagacgagctgatggaaatctcggaaagg
acaaagcagctcggagtccacaccattgtcatagataccgaggtggtggattcgtcattc
atggagatgaggctcggctactgccgggagatcgcagagatgaccggcggaaaatattat
ccgatatcgggcttgagctccgaggcgctctacagcattgtggatgaagagcagaagctg
ctcctcgaggccaacacttga

DBGET integrated database retrieval system