KEGG   Methanosaeta concilii: MCON_0725Help
Entry
MCON_0725         CDS       T01468                                 

Definition
phosphoglucomutase/phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_0725
   00030 Pentose phosphate pathway
    MCON_0725
   00051 Fructose and mannose metabolism
    MCON_0725
   00052 Galactose metabolism
    MCON_0725
   00500 Starch and sucrose metabolism
    MCON_0725
   00520 Amino sugar and nucleotide sugar metabolism
    MCON_0725
  Nucleotide metabolism
   00230 Purine metabolism
    MCON_0725
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MCON_0725
Enzymes [BR:mcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MCON_0725
    5.4.2.8  phosphomannomutase
     MCON_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(647828..649147)
Genome map
AA seq 439 aa AA seqDB search
MHVTVFRAYDVRGVYGTDLTEQLVKRVGESFGSYAEGGSVSLGRDTRISGPSLQKAFLDG
VLSTGCQVNSFGIIPIAIISFITWKEELKAAAYISASHNPPEYNGVRFRTCDGYGLLYQE
SSIMKYYREGGFLAGQGIKTDRDPGEAIERYREYVQGKLNLKRPLKLVLDMGNGAACTMA
SFYQQLGFNPLILNGTTDGLFPGRGPAPNEESLRPACQMLKKKEADFGVGFDPDADRGIV
IDDKGAVLPPEKVAIIITRARYKPGDLVISGFDCSMILERELEKDGIKVLRERVGDVFVA
NRVKNSKAVLGVERSGHFFLPEFQYSDDPFAMSLALAEIVSSGEKLSDLAGMIPDYPYKQ
MSVHLNEDPAAVMLRLADSLAFFEPDTTDGLKITTESYSVLIRPSNTEPIIRLYIETTRG
DMKELEEQYKKIIHQAMKA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtgacagtattcagagcttatgatgtcagaggtgtctacggcaccgatctcaca
gagcagttggtgaagagagttggtgaatcctttggatcttatgctgaaggtggttcagtc
tccctgggaagagatacccggatcagtggcccaagcctccagaaggcgttcctggatgga
gtactgagcacaggctgccaggttaacagctttggcatcatccccattgccataatcagc
tttatcacctggaaagaggagctcaaggccgcagcctacatatccgcctctcataatccg
ccggagtacaacggcgtgcgattcagaacctgtgacggttatggcctgctctatcaggag
tcctccataatgaagtactatcgggaggggggctttctcgctggccaggggatcaagacc
gatcgcgatccaggggaggcgatcgagagatacagggagtatgtgcaagggaagctgaac
ctcaagcgtcccctcaagctggttttagacatgggaaatggtgcagcctgcacaatggcc
tccttctaccagcagctgggttttaatcctttgattttaaacggaaccacggacggcctg
tttcccggccgaggtcccgctcccaatgaggaatctttgcgccctgcctgccagatgcta
aagaaaaaagaggcagatttcggcgtgggatttgatccggatgctgacaggggaatcgtc
atcgatgataaaggagctgtcctgcccccggagaaggtggcgatcatcatcacccgggca
aggtacaagcccggtgacctggtcatatccggcttcgactgttcaatgatcctggagcga
gagctggaaaaggatggcataaaggttctgcgagagagggtgggcgatgtcttcgtggca
aaccgggtgaaaaactcaaaagcggttctgggcgtagaacgaagcggccacttcttcctg
cccgagttccagtattctgatgatcccttcgccatgagcctcgccctggctgagatcgtg
tccagtggagagaagctctcagatctggcgggcatgatacctgattatccctataaacag
atgagcgtccacctcaatgaagacccggcagcggttatgctccgcctggccgattcactg
gctttctttgagccggacacaacagatggcttgaagatcaccaccgaaagctacagcgtt
ctcatccggccgagcaacaccgagcccatcatccggctgtatatcgagaccaccagaggg
gatatgaaagagctggaggagcaatacaaaaagatcatccaccaggcgatgaaagcctga

DBGET integrated database retrieval system