KEGG   Methanosaeta concilii: MCON_0780Help
Entry
MCON_0780         CDS       T01468                                 

Definition
(GenBank) acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mcj  Methanosaeta concilii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00620  Pyruvate metabolism
mcj00640  Propanoate metabolism
mcj00680  Methane metabolism
mcj00720  Carbon fixation pathways in prokaryotes
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
Module
mcj_M00357  Methanogenesis, acetate => methane
mcj_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_0780
   00620 Pyruvate metabolism
    MCON_0780
   00640 Propanoate metabolism
    MCON_0780
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_0780
   00680 Methane metabolism
    MCON_0780
Enzymes [BR:mcj01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MCON_0780
Lipid biosynthesis proteins [BR:mcj01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MCON_0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Fer4_7 Fer4_9 Fer4 Fer4_10 Fer4_2 Fer4_21 Fer4_8 Fer4_4 Fer4_17 Fer4_13 Fer4_16 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AEB67579
UniProt: F4BY74
Position
complement(691128..693029)
Genome map
AA seq 633 aa AA seqDB search
MTSLLPRYVSRLDFKSYDDFRENLKILVPENFNFAYDVVDVYAAECPDKCALVWCNDHGE
AKTISFKELKKLSDKAANLFQGFGIKKGDTAMLTLKSRWEFWVCMVGLNKLGAIAIPSTH
MLKAKDFLYRIKKADLKLIVCIGENGVPAEFDAAHREAGDVPLVKALVGSRDLNREGWIN
FDLELERASETFVRPKGNQATKNDDILLAYFTSGTTGYPKLVKHDQTYPLGHILTAKFWQ
NVEDDGLHYTVADTGWAKCAWGKIFGQWIAGSAVFVYDYDRFDAGRMMDEMGKYGVTTFC
APPTIFRFMIKSDMSRYDFSRLKYAVTAGEPLNPSVYESFLETTGLRLMEGYGQTETVVC
ISNYPWMEAKPGSMGKPAAGYDILLVGKNDKICEVGEEGEIVIRTDKGKPVGLFTDYHMD
PDKTQNTWHDDYYHTGDTAWRDEDGYFWFIGRTDDMIKSSGYRVGPFEVESALMSHPAVL
EVAITGVPDPIRGQVVKATVVLTQGFSPSEELKRELQDHVKKVTAPYKYPRIVEFVDELP
KTISGKIRRVEIRDKDKPYPVINSLECKACERCVEACPAGVLKMGSELNVRGYNYVLYSG
DGCIGCAACYYTCPEPLAIEVHVPQKEKSAQES
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgacatctttattgcctaggtatgtctcgcgattggatttcaaatcatacgatgacttc
agagagaacctgaagatcctcgtcccagagaacttcaatttcgcttatgacgtcgtcgat
gtttatgccgctgaatgtcctgataaatgtgcactcgtctggtgtaacgatcatggcgag
gcgaagaccatcagcttcaaagagctgaagaaattaagcgacaaagccgccaacctcttt
cagggctttgggataaagaaaggcgatacagcaatgctcaccctcaagagccgctgggag
ttctgggtgtgcatggtgggcttgaacaagctcggcgcaatcgccatcccttccacccat
atgctgaaagccaaagactttctctatcgcatcaaaaaagcagatctgaagctcatcgtc
tgcatcggtgagaacggcgttcctgcagagttcgatgccgcccacagagaggcgggagac
gttcccctggtcaaagccctggtgggaagccgggatctgaatcgggagggctggatcaac
ttcgatctggagctggaacgggcaagtgaaaccttcgttcggcctaaaggaaatcaggcg
actaaaaacgatgatatactgctggcatacttcacctccggcaccaccggctatccgaag
ctggtcaagcacgatcagacctatcccctgggacatatcctcaccgccaagttctggcag
aacgtggaggatgacggattgcattacacagttgccgataccggctgggccaaatgcgcc
tggggcaagatattcggccaatggatagcaggatcggccgtcttcgtctatgattacgac
cgcttcgatgccggaaggatgatggacgagatgggcaaatacggcgtgaccaccttctgc
gccccgcccaccatcttcaggttcatgatcaagagcgatatgtctcgctatgacttctcc
cgcctcaagtatgcagtcacagcaggcgagcccctcaacccttcggtatatgagagcttc
cttgagaccactggcctgcggctgatggagggatacggccagacggagaccgtggtctgc
atctccaactatccctggatggaggccaaaccaggatccatgggaaagcccgcagcagga
tacgatatcctcctggtgggaaagaacgacaagatctgcgaggtgggcgaggaaggggag
attgtgatcaggacggataaaggaaagccggtgggccttttcaccgactaccacatggac
ccggacaagacccagaacacctggcacgatgactattatcataccggagataccgcctgg
cgagacgaggatggatacttctggttcatcggccggacggacgacatgatcaagagctcc
ggctaccgggtggggccctttgaggtcgagtcggctctcatgtcccatcccgccgtcctg
gaggtggcaatcacaggagttcccgatcccatccgcggtcaggtggtcaaggctacggtg
gttctcacccagggattcagcccctccgaggagctgaaacgagagctgcaagaccacgtt
aaaaaggtgacggcgccctacaagtacccccgaatagtcgagttcgttgatgagcttccc
aagaccatcagcggcaagatcaggagggtggagatccgggataaggacaagccctatccg
gtgatcaattccctggaatgcaaagcatgcgagaggtgtgttgaggcctgtccggcagga
gtgctgaagatgggcagtgagctgaacgtccgcggctacaactatgtgctatactcagga
gacggatgcataggctgcgcagcctgctactacacctgtcccgagccgctggcaattgag
gtccatgtgcctcagaaagagaagtctgcgcaggagagctga

DBGET integrated database retrieval system