KEGG   Methanosaeta concilii: MCON_1374Help
Entry
MCON_1374         CDS       T01468                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mcj  Methanosaeta concilii
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MCON_1374
Enzymes [BR:mcj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MCON_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1178192..1178797)
Genome map
AA seq 201 aa AA seqDB search
MTSDAWQEIARFGRKVVSSGLTSSRFGNISICQDGRIFITATGSMLDELDSSTVVEVSLE
NPCEMDKIASIETCVHRAIYLNTGKMAIIHTHSPYAVVLSMVEMEKVEPIDSEGVLFLGE
VPIIEGKLGTDMLAKAASLALKSHMACIARGHGVFAAGGTLMEAYTAACMVEHSSLVRYL
VNCYPQGKNLYLNQHTFKSSG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcgatgcctggcaggagatcgcgcggtttggcagaaaggtcgtctcctcagga
ctcacaagctctcgattcggaaatatcagcatctgccaggatggcaggatattcatcacc
gctacgggatcgatgctcgacgagctggattcgtccacggtggtggaggtcagcttagag
aatccctgtgagatggataagattgccagcatagagacctgcgttcaccgggcgatttac
ctgaatactgggaagatggccatcatccatacccattctccatatgcggttgtcctgtct
atggtggaaatggagaaggtggagccaattgatagcgagggcgttctctttctgggagag
gtgcctataatcgagggcaagctggggaccgatatgctcgctaaggccgcatctttagcc
cttaagtcccatatggcctgcatcgcccgcgggcatggcgtatttgctgcaggcgggacc
ctgatggaggcctataccgcagcctgcatggtggagcatagctctctggtgagatatctg
gtgaattgctacccccaggggaaaaatttatatcttaaccaacacacttttaaatcgagc
gggtaa

DBGET integrated database retrieval system