KEGG   Methanothrix soehngenii: MCON_1404Help
Entry
MCON_1404         CDS       T01468                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00260  Glycine, serine and threonine metabolism
mcj00680  Methane metabolism
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
mcj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1404 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MCON_1404 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_1404 (gpmA)
Enzymes [BR:mcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MCON_1404 (gpmA)
Membrane trafficking [BR:mcj04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MCON_1404 (gpmA)
Exosome [BR:mcj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MCON_1404 (gpmA)
  Exosomal proteins of melanoma cells
   MCON_1404 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AEB68074
UniProt: F4BSW4
Position
complement(1205698..1206315)
Genome map
AA seq 205 aa AA seqDB search
MSRLVLLRHGQSLWNRERRFTGWTDIDLSFQGIEEARDAGRIMKGAGITIDVAYTSLLKR
AVRTMWIVLGEMDLTRIPVIKSWRLNERAYGDFEGRSLDEAEELYGAEQVRRWRKGFLHR
FPAPSSESLKDVQERLLPLWQGQIAADLKKGRGVLVVSHGNTIRALVKHIEEISDQNIEE
LEVHTASPILYELDGRLKLMKRIDL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaggctggtattgctcaggcacggccagagcctctggaaccgggagagaaggttc
accggctggacagacatcgatctctctttccagggaatcgaggaggcccgcgatgccggg
cggatcatgaagggagcgggcataacgattgatgttgcctatacatcccttttgaagcgg
gccgtcaggaccatgtggatagtcctgggtgagatggacctgacgcggattcccgtcatc
aagagctggaggctaaacgaacgcgcctatggggattttgagggtcggagcctggatgag
gcggaagaactgtatggcgctgagcaggtgcgaagatggcgcaaaggatttctccatcgt
ttccctgccccttcatcagaatccctgaaggatgtacaagagcgtcttctgcccctctgg
cagggccagatcgcagccgatctgaaaaaagggagaggcgttcttgtggtctcccatggc
aacaccatccgtgcccttgttaagcatattgaggagatctccgaccagaatatcgaagag
ctggaggttcataccgcttcccccatcctctatgagcttgacggccggctgaagctcatg
aagcgcatcgatctatag

DBGET integrated database retrieval system