KEGG   Methanosaeta concilii: MCON_1404Help
Entry
MCON_1404         CDS       T01468                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_1404 (gpmA)
   01230 Biosynthesis of amino acids
    MCON_1404 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1404 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MCON_1404 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_1404 (gpmA)
Enzymes [BR:mcj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MCON_1404 (gpmA)
Exosome [BR:mcj04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MCON_1404 (gpmA)
  Exosomal proteins of melanoma cells
   MCON_1404 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205698..1206315)
Genome map
AA seq 205 aa AA seqDB search
MSRLVLLRHGQSLWNRERRFTGWTDIDLSFQGIEEARDAGRIMKGAGITIDVAYTSLLKR
AVRTMWIVLGEMDLTRIPVIKSWRLNERAYGDFEGRSLDEAEELYGAEQVRRWRKGFLHR
FPAPSSESLKDVQERLLPLWQGQIAADLKKGRGVLVVSHGNTIRALVKHIEEISDQNIEE
LEVHTASPILYELDGRLKLMKRIDL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaaggctggtattgctcaggcacggccagagcctctggaaccgggagagaaggttc
accggctggacagacatcgatctctctttccagggaatcgaggaggcccgcgatgccggg
cggatcatgaagggagcgggcataacgattgatgttgcctatacatcccttttgaagcgg
gccgtcaggaccatgtggatagtcctgggtgagatggacctgacgcggattcccgtcatc
aagagctggaggctaaacgaacgcgcctatggggattttgagggtcggagcctggatgag
gcggaagaactgtatggcgctgagcaggtgcgaagatggcgcaaaggatttctccatcgt
ttccctgccccttcatcagaatccctgaaggatgtacaagagcgtcttctgcccctctgg
cagggccagatcgcagccgatctgaaaaaagggagaggcgttcttgtggtctcccatggc
aacaccatccgtgcccttgttaagcatattgaggagatctccgaccagaatatcgaagag
ctggaggttcataccgcttcccccatcctctatgagcttgacggccggctgaagctcatg
aagcgcatcgatctatag

DBGET integrated database retrieval system