KEGG   Methanosaeta concilii: MCON_1467Help
Entry
MCON_1467         CDS       T01468                                 

Gene name
vorC
Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_1467 (vorC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1467 (vorC)
   00020 Citrate cycle (TCA cycle)
    MCON_1467 (vorC)
   00620 Pyruvate metabolism
    MCON_1467 (vorC)
   00640 Propanoate metabolism
    MCON_1467 (vorC)
   00650 Butanoate metabolism
    MCON_1467 (vorC)
  Energy metabolism
   00680 Methane metabolism
    MCON_1467 (vorC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1467 (vorC)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1467 (vorC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264124..1264660
Genome map
AA seq 178 aa AA seqDB search
MKEIRLHGRGGQGSVTAAEIIAVAAFEDKRFSQAFPAFGVERRGAPVMAFARIADKPIRV
RSQIYEPDYVIVQDVTLLDVVDVASGLKPDGKIIINTDRSGEQLKLDTKAEVITIDATKI
AMEVLGRPIVNTTMLGAFCGASGEVGLESLNKAISERFRGELGKKNLLAIKTAYERVS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagatacgattacacggccgtggaggtcagggatcggtcacggcagctgagata
atagccgttgccgcctttgaggataagaggttctctcaggcatttcctgcctttggagta
gaacggaggggtgcgccggttatggcctttgcccgaatagccgataaacccatccgagtg
aggagccagatatacgaaccagactatgtcatcgtccaggacgtgacccttttggacgtg
gtcgatgtggccagtggactcaaaccggacggcaagataataatcaacaccgaccgttca
ggtgagcagctcaagcttgacacaaaggccgaggtcatcaccatcgatgccaccaagatc
gccatggaggttttgggaaggcccattgtgaacaccacaatgctgggcgcattctgcggt
gccagcggagaggtggggctggagagcctgaacaaagccatatccgagcgtttccgggga
gaattggggaagaaaaacctgctggccattaaaacagcctacgagagggtttcttga

DBGET integrated database retrieval system