KEGG   Methanosaeta concilii: MCON_1468Help
Entry
MCON_1468         CDS       T01468                                 

Gene name
porD
Definition
pyruvate oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_1468 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1468 (porD)
   00020 Citrate cycle (TCA cycle)
    MCON_1468 (porD)
   00620 Pyruvate metabolism
    MCON_1468 (porD)
   00640 Propanoate metabolism
    MCON_1468 (porD)
   00650 Butanoate metabolism
    MCON_1468 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_1468 (porD)
   00680 Methane metabolism
    MCON_1468 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1468 (porD)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1468 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1264660..1264917
Genome map
AA seq 85 aa AA seqDB search
MEIKAGKLVDPCSTRITKTGAWRTFVPVVDHKACIKCSLCAIYCPEGCIHQVDGQFVPDL
DYCKGCSVCANECPRMAITMVLEDK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaggctggtaaactggtagatccgtgcagcaccagaataacgaagaccggt
gcctggcggacttttgtgcccgttgtcgatcataaggcatgtataaaatgcagcctctgt
gcgatctactgtccagagggctgcatccaccaggtagatgggcagtttgtccctgacctg
gattactgcaaaggctgcagcgtgtgtgccaatgaatgcccacgcatggcgattaccatg
gtcttggaggataagtga

DBGET integrated database retrieval system