KEGG   Methanothrix soehngenii: MCON_1468Help
Entry
MCON_1468         CDS       T01468                                 

Gene name
porD
Definition
(GenBank) pyruvate oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00020  Citrate cycle (TCA cycle)
mcj00620  Pyruvate metabolism
mcj00633  Nitrotoluene degradation
mcj00640  Propanoate metabolism
mcj00650  Butanoate metabolism
mcj00680  Methane metabolism
mcj00720  Carbon fixation pathways in prokaryotes
mcj01100  Metabolic pathways
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
Module
mcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1468 (porD)
   00020 Citrate cycle (TCA cycle)
    MCON_1468 (porD)
   00620 Pyruvate metabolism
    MCON_1468 (porD)
   00640 Propanoate metabolism
    MCON_1468 (porD)
   00650 Butanoate metabolism
    MCON_1468 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_1468 (porD)
   00680 Methane metabolism
    MCON_1468 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1468 (porD)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1468 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_9 Fer4_6 Fer4_16 Fer4_7 Fer4_2 Fer4_10 Fer4_17 Fer4_15 Fer4_4 Fer4_13 Fer4_8
Motif
Other DBs
NCBI-ProteinID: AEB68125
UniProt: F4BTC0
Position
1264660..1264917
Genome map
AA seq 85 aa AA seqDB search
MEIKAGKLVDPCSTRITKTGAWRTFVPVVDHKACIKCSLCAIYCPEGCIHQVDGQFVPDL
DYCKGCSVCANECPRMAITMVLEDK
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaggctggtaaactggtagatccgtgcagcaccagaataacgaagaccggt
gcctggcggacttttgtgcccgttgtcgatcataaggcatgtataaaatgcagcctctgt
gcgatctactgtccagagggctgcatccaccaggtagatgggcagtttgtccctgacctg
gattactgcaaaggctgcagcgtgtgtgccaatgaatgcccacgcatggcgattaccatg
gtcttggaggataagtga

DBGET integrated database retrieval system