KEGG   Methanosaeta concilii: MCON_1469Help
Entry
MCON_1469         CDS       T01468                                 

Gene name
porA
Definition
(GenBank) pyruvate oxidoreductase subunit alpha
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mcj  Methanosaeta concilii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00020  Citrate cycle (TCA cycle)
mcj00620  Pyruvate metabolism
mcj00633  Nitrotoluene degradation
mcj00640  Propanoate metabolism
mcj00650  Butanoate metabolism
mcj00680  Methane metabolism
mcj00720  Carbon fixation pathways in prokaryotes
mcj01100  Metabolic pathways
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
Module
mcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1469 (porA)
   00020 Citrate cycle (TCA cycle)
    MCON_1469 (porA)
   00620 Pyruvate metabolism
    MCON_1469 (porA)
   00640 Propanoate metabolism
    MCON_1469 (porA)
   00650 Butanoate metabolism
    MCON_1469 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_1469 (porA)
   00680 Methane metabolism
    MCON_1469 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1469 (porA)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1469 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEB68126
UniProt: F4BTC1
Position
1264917..1266134
Genome map
AA seq 405 aa AA seqDB search
MSKGSDSSMPQNTANMRVVEGSYAVAHAVMCCRPDVISAYPITPQTHIVENLSQLVADGE
LDSAFLTVDSEFSALSLLVGSTACGGRGYSSTTSQGLALMYEVLYNVSGMRLPIVMTVAN
RAIGAPLNIWNDQQDSIGARDVGWLQIYVENVQEAVDATLQAYKIAEDPEIRTPIMVCMD
GFILTHVYEPVELLDKEKAREFLPDFKPANILDPNNPLTFGAFADPSTYTEFRYQQFEAH
QKALEKIEQVARDFEKAFGRYYGGLIDSYYADDAEVVLVTLGSVIGTVKDAIDELRAEGL
KVGLIKIRCYRPFPVAALRKALSGAKVIAVLEKDVAIGSEAGLLTDLKAAFYNTQIRTPI
IGFAAGLGGRDITLKDIRKIVEKALAAEKGIECEFEFLDLRKEIL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggaagcgatagcagtatgccccagaatactgcaaatatgagagtggttgag
ggctcctatgcagtggcccatgcggtcatgtgttgccggccggatgtgatctccgcctat
cccattacccctcagacccatattgtggaaaacctctcccagttggtggctgatggcgag
ctggacagcgcattcctgacggttgactccgagttctcggcgctctccctcctggtcggc
tccaccgcatgcggcggcagaggctactcctcgaccaccagccagggattggctctgatg
tacgaggtcctctacaacgtctcaggcatgaggcttcccattgtgatgaccgtggccaac
cgcgccattggggctcccctgaacatctggaacgaccagcaggattccattggcgctcgc
gacgtgggatggctgcagatctatgtggagaatgtgcaggaagcagtggatgccaccctt
caggcctataagatcgccgaagatccggagatccgaactccgatcatggtctgcatggac
gggttcatcctcacccatgtctacgagccggtggagctcctggacaaagagaaggcaagg
gaatttctgcctgatttcaagccggcaaacatcctggacccgaacaatccccttaccttt
ggagccttcgccgatccatccacctatacggagttccgctatcagcagttcgaggcccat
caaaaggcgctggaaaagatagagcaggtggccagggacttcgagaaggcctttggccga
tattacggtgggctcatagacagctattacgccgatgatgcagaggtggttttagtcact
ttgggctcagtcatcggcaccgtcaaggatgccatcgatgaattgagggcggagggcctc
aaggtgggcctgatcaagatcagatgctatcggcctttcccggttgcagccctgcgcaag
gccctgtccggcgccaaggtgatcgcggtgttggagaaggacgtcgccataggaagcgag
gctggtctgctgacggatctcaaggcagcattctataacacccagatcagaacgcctatt
atcggctttgccgccggtctgggaggccgggacatcactctcaaggacataagaaagata
gtagagaaagcccttgccgccgagaagggaatcgagtgcgagttcgagttcctggatctg
agaaaggagattctttag

DBGET integrated database retrieval system