KEGG   Methanosaeta concilii: MCON_1470Help
Entry
MCON_1470         CDS       T01468                                 

Gene name
porB
Definition
(GenBank) pyruvate oxidoreductase subunit beta
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mcj  Methanosaeta concilii
Pathway
mcj00010  Glycolysis / Gluconeogenesis
mcj00020  Citrate cycle (TCA cycle)
mcj00620  Pyruvate metabolism
mcj00633  Nitrotoluene degradation
mcj00640  Propanoate metabolism
mcj00650  Butanoate metabolism
mcj00680  Methane metabolism
mcj00720  Carbon fixation pathways in prokaryotes
mcj01100  Metabolic pathways
mcj01120  Microbial metabolism in diverse environments
mcj01130  Biosynthesis of antibiotics
mcj01200  Carbon metabolism
Module
mcj_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1470 (porB)
   00020 Citrate cycle (TCA cycle)
    MCON_1470 (porB)
   00620 Pyruvate metabolism
    MCON_1470 (porB)
   00640 Propanoate metabolism
    MCON_1470 (porB)
   00650 Butanoate metabolism
    MCON_1470 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_1470 (porB)
   00680 Methane metabolism
    MCON_1470 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1470 (porB)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1470 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEB68127
UniProt: F4BTC2
Position
1266148..1267023
Genome map
AA seq 291 aa AA seqDB search
MERSLLAPGHRACAGCAMPTTIRLVLDAAGPNTIVVSPTGCLEVVTTPFPESAWCVPWIH
SLFENPAAVASGVEVMLKRRGQDTNVVVIGGDGSTFDIGMGSNSGMFERGHKVLYVCYDN
EAYMNTGVQRSGSTPFCVHTTTTPSGSESMGNPRPKKDMPAIALAHGVPYVATASVAYPV
DLRRKVKEALKANGPSYIQVNAPCITGWTFDAGTMIELARLAVETGLWPLTEYVDGKLVG
VKKIRRPKPVEEYLRLQGRYKHLFKKPNGADMLKHIKALADGNIARYNLVD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatctttgctggcaccgggccaccgggcctgtgcgggatgcgccatgcccacc
accatcaggctggtcttggatgcggccgggccgaataccattgtggtctcgcccaccggc
tgcctggaggttgtcaccacccccttcccggagagcgcctggtgcgttccctggattcac
tccctgttcgaaaacccagctgcagtggcctctggcgtggaggtcatgctcaagcgccgg
ggccaggataccaatgttgtggtgataggaggagacgggagcacattcgatatcggtatg
ggctcgaactccggcatgttcgagcgcggccataaggtgctttatgtctgctatgacaac
gaggcttatatgaacaccggagtgcagcgcagcggctccacgcccttctgcgttcacaca
accaccaccccatcaggatcagaatcgatgggcaatccccggcccaagaaggatatgccg
gccatcgccctggctcatggtgtgccctatgtggctaccgcctcagtggcctatccggtg
gacctgagaaggaaggtcaaggaggctctaaaggccaatggaccatcctatatccaggtc
aacgctccctgcatcactggctggacattcgatgctggaaccatgattgagctagctcgt
ctcgcagtggagactggcctgtggcccctcacggagtatgtcgatggaaagctggtgggg
gtgaagaagatccgccgacccaaacctgtcgaggagtatctccgcctgcagggccgctac
aagcatctcttcaagaagcccaatggcgcggatatgttgaagcatatcaaagcactggca
gatggaaacatcgccaggtataatctggttgattga

DBGET integrated database retrieval system