KEGG   Methanosaeta concilii: MCON_1470Help
Entry
MCON_1470         CDS       T01468                                 

Gene name
porB
Definition
pyruvate oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_1470 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_1470 (porB)
   00020 Citrate cycle (TCA cycle)
    MCON_1470 (porB)
   00620 Pyruvate metabolism
    MCON_1470 (porB)
   00640 Propanoate metabolism
    MCON_1470 (porB)
   00650 Butanoate metabolism
    MCON_1470 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MCON_1470 (porB)
   00680 Methane metabolism
    MCON_1470 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MCON_1470 (porB)
Enzymes [BR:mcj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MCON_1470 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1266148..1267023
Genome map
AA seq 291 aa AA seqDB search
MERSLLAPGHRACAGCAMPTTIRLVLDAAGPNTIVVSPTGCLEVVTTPFPESAWCVPWIH
SLFENPAAVASGVEVMLKRRGQDTNVVVIGGDGSTFDIGMGSNSGMFERGHKVLYVCYDN
EAYMNTGVQRSGSTPFCVHTTTTPSGSESMGNPRPKKDMPAIALAHGVPYVATASVAYPV
DLRRKVKEALKANGPSYIQVNAPCITGWTFDAGTMIELARLAVETGLWPLTEYVDGKLVG
VKKIRRPKPVEEYLRLQGRYKHLFKKPNGADMLKHIKALADGNIARYNLVD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggaaagatctttgctggcaccgggccaccgggcctgtgcgggatgcgccatgcccacc
accatcaggctggtcttggatgcggccgggccgaataccattgtggtctcgcccaccggc
tgcctggaggttgtcaccacccccttcccggagagcgcctggtgcgttccctggattcac
tccctgttcgaaaacccagctgcagtggcctctggcgtggaggtcatgctcaagcgccgg
ggccaggataccaatgttgtggtgataggaggagacgggagcacattcgatatcggtatg
ggctcgaactccggcatgttcgagcgcggccataaggtgctttatgtctgctatgacaac
gaggcttatatgaacaccggagtgcagcgcagcggctccacgcccttctgcgttcacaca
accaccaccccatcaggatcagaatcgatgggcaatccccggcccaagaaggatatgccg
gccatcgccctggctcatggtgtgccctatgtggctaccgcctcagtggcctatccggtg
gacctgagaaggaaggtcaaggaggctctaaaggccaatggaccatcctatatccaggtc
aacgctccctgcatcactggctggacattcgatgctggaaccatgattgagctagctcgt
ctcgcagtggagactggcctgtggcccctcacggagtatgtcgatggaaagctggtgggg
gtgaagaagatccgccgacccaaacctgtcgaggagtatctccgcctgcagggccgctac
aagcatctcttcaagaagcccaatggcgcggatatgttgaagcatatcaaagcactggca
gatggaaacatcgccaggtataatctggttgattga

DBGET integrated database retrieval system