KEGG   Methanosaeta concilii: MCON_1689Help
Entry
MCON_1689         CDS       T01468                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mcj  Methanosaeta concilii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MCON_1689
Enzymes [BR:mcj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MCON_1689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1447501..1448514)
Genome map
AA seq 337 aa AA seqDB search
MLSISRAIHISMPFEECSISHKGVLVVGGIIVDLIARSEKFKVVNDNLCFPFDSKITLDQ
LSQDTGGSAHNLATNLAELGTTTYILGSVGKEDHGEEYLRNLRIHGAITKYVTLKEGLTG
MSLVFLYNGEKTVLTSRGANALLGEEDLNPEVFDKIDTMVLTSLISQENMALMKKAIEEA
KKRGIYIITNPSMSMVNHRPEELKHAMHNSQVIIMNGKESMLITGEKDVDSAIKKLKDYG
AETVIVTLDVRGALVLDNERTFRVPSYKVKVVDTTGGGDSFTAGFIHAKYHGYSNEEAVK
FASAVAALNIVTPGASTDLPSENDVVEFMKTAEFLEA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttatctatcagcagagctatccatatcagcatgccatttgaagaatgcagcattagc
cataagggcgtgctcgtagtgggcggtataatcgtagacctgattgccagatctgagaag
ttcaaggtggtaaatgacaacctctgttttcccttcgactccaagatcaccctcgatcag
ctcagccaggataccggaggctcagcacacaacctggcaaccaacctggcagaattgggc
acaaccacttacatcctcggttcagtgggcaaagaggaccacggcgaggaatacctgaga
aacctgaggattcacggcgcaatcaccaaatatgtcaccttaaaggagggcctgaccggg
atgtctttggtctttctctataacggcgagaagaccgttctgaccagcagaggggccaat
gccctgctgggtgaagaggacctcaatcctgaggtctttgataagatcgataccatggtc
cttaccagcctgataagccaggagaatatggcgctgatgaaaaaggccatagaagaggcg
aaaaaaagaggtatctacatcatcacgaatcccagcatgagcatggtcaaccaccgacca
gaggagctgaagcatgccatgcataacagccaggtgataatcatgaacggcaaggagtcg
atgctgataaccggggagaaggatgtcgattccgctatcaagaagctgaaggattatgga
gcagagacggtgatcgtcaccctggatgtcagaggcgcgctggttttggataatgaacgg
accttccgggtgccctcctacaaggtcaaagtggtggacacgaccggcgggggagatagc
ttcaccgctggattcatccatgccaaataccatggatactcgaatgaagaagctgtaaag
ttcgcctccgctgtggccgccctgaacatcgtcaccccgggagcgagcaccgacctgccc
agcgaaaacgatgtggtcgagttcatgaagacggcggagtttctggaggcttga

DBGET integrated database retrieval system