KEGG   Methanosaeta concilii: MCON_1800Help
Entry
MCON_1800         CDS       T01468                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mcj  Methanosaeta concilii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCON_1800 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_1800 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCON_1800 (trpA)
Enzymes [BR:mcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCON_1800 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1536825..1537601)
Genome map
AA seq 258 aa AA seqDB search
MRITEAFEKGPLLIVYLCSGDPSPGATPELVRRLVRAGADIIELGLPHSDPIADGPTIQA
AAQRAIAAGMNTDVYFQVAEEADVPVPKVFMGYYNMVYARGLERFARDCARCGITGMIVP
DLPPEEAAPLKEACGKHGVDLIYLVAPNTPPARIDLIAEETGGFLYLVARTGVTGARSEV
LQDTRDLILRVPGKKPKAVGFGISTPDQAAEVIRAGADAAIVGSACVDLIARGRIDELEA
LVGEMKKAVKAAGRARLQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagaataactgaggccttcgagaaagggcccctgctgatcgtctatctctgctcagga
gacccgtcgcccggtgccacccccgagctggtgcgccggcttgtgagggcgggagcggat
atcatcgagctggggctcccccattcagaccctatagcggacggtccgaccatccaggcg
gcagcgcaaagggctatcgctgcggggatgaacaccgatgtatacttccaggtggcagaa
gaggctgatgtgcccgtccccaaggtattcatgggttactacaatatggtctatgcccgg
ggcctggagaggtttgcccgggactgtgcccgctgtggcatcaccggcatgatcgttccc
gacctgcccccggaggaggccgcgcccctgaaagaggcctgcggcaagcacggcgtggac
ctgatctacctggtggcaccaaacacgccccccgcacggatcgatctgatcgctgaagag
acgggcggctttctctatctggtggccaggaccggcgtcaccggggcgagaagcgaggtc
ttgcaggatacaagagacctcatccttcgggtgccgggaaaaaagccaaaggcggtggga
ttcggcatctccacccctgaccaggcggctgaggtcatccgggcgggtgccgatgccgcc
atagtgggatcggcctgcgtggacctgatcgccaggggcaggatcgatgagctggaggca
ttggttggggagatgaaaaaggcggtaaaagctgcggggagagcaaggctgcaatag

DBGET integrated database retrieval system