KEGG   Methanothrix soehngenii: MCON_1801Help
Entry
MCON_1801         CDS       T01468                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcj  Methanothrix soehngenii
Pathway
mcj00260  Glycine, serine and threonine metabolism
mcj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcj01100  Metabolic pathways
mcj01110  Biosynthesis of secondary metabolites
mcj01130  Biosynthesis of antibiotics
mcj01230  Biosynthesis of amino acids
Module
mcj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_1801 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCON_1801 (trpB)
Enzymes [BR:mcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCON_1801 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEB68403
UniProt: F4BVG9
Position
complement(1537588..1538769)
Genome map
AA seq 393 aa AA seqDB search
MIDNFAVKFGRYGGLFVPETLVAPLADLSIAYDRLKKSPQFQDELKALQKDFAGRPTSLY
LAPNLSRKLGCRVYLKREDLMHGGAHKLNNTLGQALVAKNMGKTRLIAETGAGQHGVATA
IVGAKLGFETQVYMGEVDIERQKMNVYRMELMGAEVIPVRSGSRTLKDAINEALRDWASS
FEHTHYLLGTAAGAHPFPSMVRDFQSVIGQEAREQILEAEGRLPDSIVACVGGGSNAMGI
FTPFLKDDVRLIAVEAGGRGPGMSDKMADNGASLGYGTDGILHGALTKILQDPYGQILES
YSVAAGLDYPGVGPELAFLAEKGRVLPRLADDRTALEGFRALSRLEGIIPALESAHAIGY
ALREPESLGDLVIINVSGRGDKDLATVMDYENN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataatttcgcagtcaagttcgggaggtatggcggcctcttcgtccccgagacc
ctggtggctcccttggccgacctctctattgcctatgaccggctcaagaagagcccccaa
tttcaagatgagctgaaagctctccaaaaggacttcgccggccggcccacatcgctttat
cttgcccccaacctcagccggaagctgggctgccgggtgtatctaaagagggaggacctg
atgcacggtggggctcataagctcaacaacacccttggccaggctctggtggcaaagaat
atgggcaagacccgcctgatcgccgagaccggagccggccagcatggcgtggccacggcc
atcgtgggggcaaaactgggctttgagacccaggtctacatgggtgaggtggacatcgag
aggcagaagatgaacgtctaccggatggagctgatgggagcagaggtgataccggtccgc
tccggctccaggactctgaaggacgccataaacgaggctttgagggactgggcctccagc
ttcgagcacacccactatctgctgggaaccgccgccggcgctcatcccttcccctcgatg
gtcagggactttcagagcgtgatcggccaggaggcccgggagcagatcctggaggcggaa
ggtcgtctgccggatagcattgtggcctgcgtgggtggagggagcaatgccatgggcatc
ttcactccattcctgaaggacgatgtgaggctgatcgcagtggaggcaggaggtcgaggc
ccggggatgagcgacaagatggcagacaacggcgcatctttgggctacggcacagacgga
atactgcatggtgccctcaccaagatcctccaggacccatacggccagatactggaatcc
tactcagtggcagcaggccttgactatcccggagtgggtccggagctggcattcctggcg
gagaagggacgcgtccttcccaggctggcggacgacaggaccgctctagagggattccgc
gccctatcccggctggaggggatcatccccgcactggagtcggctcatgccatcggctat
gcattaagagagcctgaatcactgggcgatcttgtgatcatcaatgtctccggccgggga
gataaggacctggctacggtgatggactatgagaataactga

DBGET integrated database retrieval system