KEGG   Methanosaeta concilii: MCON_1801Help
Entry
MCON_1801         CDS       T01468                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcj  Methanosaeta concilii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCON_1801 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_1801 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCON_1801 (trpB)
Enzymes [BR:mcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCON_1801 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1537588..1538769)
Genome map
AA seq 393 aa AA seqDB search
MIDNFAVKFGRYGGLFVPETLVAPLADLSIAYDRLKKSPQFQDELKALQKDFAGRPTSLY
LAPNLSRKLGCRVYLKREDLMHGGAHKLNNTLGQALVAKNMGKTRLIAETGAGQHGVATA
IVGAKLGFETQVYMGEVDIERQKMNVYRMELMGAEVIPVRSGSRTLKDAINEALRDWASS
FEHTHYLLGTAAGAHPFPSMVRDFQSVIGQEAREQILEAEGRLPDSIVACVGGGSNAMGI
FTPFLKDDVRLIAVEAGGRGPGMSDKMADNGASLGYGTDGILHGALTKILQDPYGQILES
YSVAAGLDYPGVGPELAFLAEKGRVLPRLADDRTALEGFRALSRLEGIIPALESAHAIGY
ALREPESLGDLVIINVSGRGDKDLATVMDYENN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatcgataatttcgcagtcaagttcgggaggtatggcggcctcttcgtccccgagacc
ctggtggctcccttggccgacctctctattgcctatgaccggctcaagaagagcccccaa
tttcaagatgagctgaaagctctccaaaaggacttcgccggccggcccacatcgctttat
cttgcccccaacctcagccggaagctgggctgccgggtgtatctaaagagggaggacctg
atgcacggtggggctcataagctcaacaacacccttggccaggctctggtggcaaagaat
atgggcaagacccgcctgatcgccgagaccggagccggccagcatggcgtggccacggcc
atcgtgggggcaaaactgggctttgagacccaggtctacatgggtgaggtggacatcgag
aggcagaagatgaacgtctaccggatggagctgatgggagcagaggtgataccggtccgc
tccggctccaggactctgaaggacgccataaacgaggctttgagggactgggcctccagc
ttcgagcacacccactatctgctgggaaccgccgccggcgctcatcccttcccctcgatg
gtcagggactttcagagcgtgatcggccaggaggcccgggagcagatcctggaggcggaa
ggtcgtctgccggatagcattgtggcctgcgtgggtggagggagcaatgccatgggcatc
ttcactccattcctgaaggacgatgtgaggctgatcgcagtggaggcaggaggtcgaggc
ccggggatgagcgacaagatggcagacaacggcgcatctttgggctacggcacagacgga
atactgcatggtgccctcaccaagatcctccaggacccatacggccagatactggaatcc
tactcagtggcagcaggccttgactatcccggagtgggtccggagctggcattcctggcg
gagaagggacgcgtccttcccaggctggcggacgacaggaccgctctagagggattccgc
gccctatcccggctggaggggatcatccccgcactggagtcggctcatgccatcggctat
gcattaagagagcctgaatcactgggcgatcttgtgatcatcaatgtctccggccgggga
gataaggacctggctacggtgatggactatgagaataactga

DBGET integrated database retrieval system