KEGG   Methanosaeta concilii: MCON_1886Help
Entry
MCON_1886         CDS       T01468                                 

Definition
histone acetyltransferase, ELP3 family protein (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mcj  Methanosaeta concilii
Brite
Enzymes [BR:mcj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MCON_1886
Transfer RNA biogenesis [BR:mcj03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MCON_1886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616294..1617841
Genome map
AA seq 515 aa AA seqDB search
MDRLAAGLRSIAEAILMGEIGDEAALEAAKKRLSAQLGLASLPSNADILGQARAGEREAL
KMLIRKPTRTLSGVAVIAAMTSPARCPHGTCVPCPGGILNLSPQSYTGKEPAALRAEQHG
FDPYDQVTARLAQLDEIGHPLDKSELIIMGGTITSRPLGYQNWFVKRCLQAMNDFPDGRE
SSGWQPFESVARANESALVRNIGTTFETRPDWCRPRDIEEMLRLGATKVELGVQSLDEDL
LVRMKRGHKVEDAAQASANLREAGLKVGFHMMPGLPGSSPDLDLAVFRELFSDSRFRPDY
LKIYPTLVIEGTELYRQYLRGEYTPLGDDDAAELVSRIKETLPRYVRLQRVQRDIPSPLI
VAGVKKSNLRQLAKKRLEDRGSSCRCIRCREAGLRRVVQAEPRLVHESYIASGAREHFLS
FESEDDVLVGFLRLRLSTSARVRELHVYGPMVPIGKRKDGWQHRGYGARLMEAAERLAQE
AGYPLIEVTSGIGARGYYRRRGYDLCPPYMVKRLR
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
ttggatagactagctgccgggctgcgcagcattgcagaggcgatcctcatgggagagata
ggggatgaggcagctcttgaagcggccaagaagaggctctctgctcaactgggcctggcc
tccttgcccagcaatgccgatatcctgggccaggcaagggctggggaacgagaggctttg
aagatgctgatcagaaagccgactcgaaccctctctggggtggcggtcatcgctgccatg
acctctcctgctcgctgccctcatgggacctgcgtcccctgcccggggggaatcttaaac
ctctcgcctcaaagctacactggtaaggagccggcggcacttcgagccgagcagcacggt
tttgatccttatgaccaggtaacggcaaggctagcccagctggatgagatcggccaccct
ctggacaagtcggagctgatcatcatgggggggacgatcacctcccgtcccctgggatat
cagaactggtttgtcaagcgctgtcttcaggccatgaacgactttcccgacggacgggag
agctctggctggcagcccttcgagtcggtggccagggcgaatgagtccgctctggtcaga
aacatcggtaccacctttgagaccaggccggactggtgccgcccccgggatatagaagag
atgctgcggctgggggcgaccaaggtggagctgggggtgcagagcctggatgaggacctg
ctggtgaggatgaaacgggggcataaggtcgaggatgctgcccaggccagcgccaacctg
cgagaggcagggctgaaggtgggattccacatgatgcccggccttcccggctccagcccg
gatctggatttagcggtattcagggagctcttctccgatagccgctttcgtcctgactac
ctgaagatctatcccacgctggtcatcgagggtacggagctataccgtcagtacctgcgg
ggtgagtatactcccctgggggatgatgatgcggcagagctagtctcacgaatcaaggag
accctaccccgatatgttcgcctgcagcgggtgcagagggatataccatcccctctgatc
gtggctggggtgaagaagtccaatcttcgtcagctggccaaaaagaggctggaggatcgg
ggcagcagctgccgctgcatccgctgtcgggaggcgggattgagacgggtggtccaggcc
gaacccaggctggtgcacgaatcctatatcgcctccggagcgagagagcacttcctctcc
tttgagagcgaggatgatgtcctggtgggatttttgcgcctgcgcctgagcacctccgcc
cgggtgcgagagctgcatgtctacggccccatggttcccatcggcaagaggaaggacgga
tggcagcatcggggctatggagcccggctgatggaggcggcggagaggctggcccaggag
gcggggtatcccctgatagaggtcaccagcggcataggggcgaggggctactatcgccgg
cgggggtacgatctatgcccgccttatatggtaaagaggctcagatag

DBGET integrated database retrieval system