KEGG   Methanosaeta concilii: MCON_2025Help
Entry
MCON_2025         CDS       T01468                                 

Gene name
purN
Definition
phosphoribosylglycinamide formyltransferase (EC:2.1.2.2)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
mcj  Methanosaeta concilii
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mcj00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mcj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723407..1724021
Genome map
AA seq 204 aa AA seqDB search
MTATIGIISSGRGENLRYILLAERDGYLPAQVKIVLADQPDAGALRIAQEFGVRHMYLDP
AGRSREEYDQQLVSHLEGAGVDLVVLTGYMRILSPRFVRHYKNRILNIHPALLPSFRGLD
AFSQALEHGVMWTGTTIHLVDEDVDHGPIIYQMPVPVKRNDTHESLKARIQRAEYRAYPR
AIKMFIEGNPEVVGRKIVFENGAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgccaccattggcatcatatcctccggaagaggagagaaccttcgctacattctg
ctggcggagcgggatggttatcttcctgcccaggtcaaaatagtcctggccgatcagccg
gacgctggagccctccggatcgctcaagagtttggtgttcgtcatatgtatctggatcca
gcgggaaggagtcgagaggagtatgaccaacagctcgtgtcgcatctggagggggcaggg
gtggacctggtggttctcaccggctatatgaggatcctgtcacctcgattcgttcgccat
tataaaaatagaattttaaatatacatcctgctctcttgccctcgttccggggattggat
gccttcagccaggccctggagcatggagtgatgtggactggcaccaccattcatctcgtc
gatgaggatgtcgatcacggaccgatcatctatcagatgccggtgccggtgaagaggaac
gatacccatgagagtctaaaggccaggatccagagggcagagtacagggcctatcccagg
gcgataaagatgttcatcgaggggaatcctgaagtggtgggaaggaagatcgtctttgag
aatggggcgaaatga

DBGET integrated database retrieval system