KEGG   Methanosaeta concilii: MCON_2511Help
Entry
MCON_2511         CDS       T01468                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcj  Methanosaeta concilii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MCON_2511
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MCON_2511
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MCON_2511
Enzymes [BR:mcj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MCON_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2149463..2150815
Genome map
AA seq 450 aa AA seqDB search
MKIKYLLDEEEIPKKWYNVAADMPTPLKPPLNPGTLKPLTAQDMEAIFPKALIQQEMSTE
RWIDIPEEVREILKLWRPTPLYRAASLEKALKTPAKIYYKYEGVSPAGSHKPNTAIPQAY
YNMKEGIERLATETGAGQWGSALSLATCLFGLQCTVYMVRSSFDSKPYRKSAMRVWGAEC
LSSPSDRTNFGRQIREKMPDTPGSLGIAISEAVEDAASHDNTNYSLGSVLNHVLLHQTIE
GQELKKQFDMTEDYPDVMFGCCGGGSNFPGMVFPFIPDKLKDKKDLRMVACEPTACPTLT
EGLFAYDYGDTAGMAPVIMMYTLGHDFIPPGIHAGGLRYHGDAPLLSNLVHDGLIEATAL
QQTEVFEAATLFARTEGIIPAPESAHAIKPAIDEALNCRKTGEEKVIFISLSGHGHFDLS
SYDAYNDGKLVDYVYPAELVKQSLAKLPKP
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcaagtacttgctcgacgaggaagagatacccaaaaagtggtacaacgtagcc
gcagatatgccaacgcccttgaaaccgcctttgaatccaggaacgctcaagccgctgact
gcccaggatatggaagcgatctttcccaaagcgcttatccagcaggagatgagcactgag
cgctggatagatatcccagaggaggtacgcgagatcctcaagctatggaggcccactccg
ctttatcgggccgcttccctggagaaggcgctcaagacccctgcaaagatatactataaa
tatgagggtgtgagccccgccggtagccataagccaaataccgctatccctcaggcctac
tacaatatgaaggagggaatagagaggctggcgacggagaccggagccgggcagtggggc
tcggccctaagcctggccacctgtttattcggcctgcagtgcacagtctatatggtcaga
tcaagcttcgatagcaagccctaccgcaagagcgccatgcgagtctggggcgctgaatgc
ctatctagcccctcggaccggacgaacttcggccggcagattagggaaaagatgcctgac
acgccgggaagcctgggaatagccatatctgaggcggtggaggatgcagcaagccatgat
aacaccaactattcattgggatcggtcctaaaccatgtcctgctccaccagaccatcgag
ggccaggagctgaaaaagcagttcgatatgactgaggactatcccgatgtgatgttcggc
tgctgcggtggagggagcaacttcccaggaatggtcttccccttcattcccgataaacta
aaggacaaaaaggacctgagaatggtagcctgcgagcccacagcctgccctacccttact
gaaggtctctttgcttatgactacggcgataccgcaggcatggcgccggtgatcatgatg
tacaccctgggccatgatttcattccaccgggcattcacgcaggcggcctgcgctaccat
ggagatgcaccactgctcagcaatctggtgcacgacggcctgatcgaggccactgctctg
cagcagactgaggtcttcgaggcggccaccctcttcgcccgcactgagggcataatcccc
gccccagaatctgcccatgctatcaagccggccatagacgaggcccttaactgcaggaag
accggagaagagaaggtcatcttcatctccctgagcggccacggccacttcgatctgtca
tcctatgatgcctataacgatggcaagctggtggactatgtatatcccgccgaattggtc
aagcagtccctggccaagctgcctaaaccctga

DBGET integrated database retrieval system