KEGG   Methanosaeta concilii: MCON_2528Help
Entry
MCON_2528         CDS       T01468                                 

Definition
thermophile-specific fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mcj  Methanosaeta concilii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCON_2528
   01230 Biosynthesis of amino acids
    MCON_2528
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCON_2528
   00030 Pentose phosphate pathway
    MCON_2528
   00051 Fructose and mannose metabolism
    MCON_2528
  Energy metabolism
   00680 Methane metabolism
    MCON_2528
Enzymes [BR:mcj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MCON_2528
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MCON_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2164763..2165878
Genome map
AA seq 371 aa AA seqDB search
MTKITISLIKADVGGYPGHCSVHPELIKTAEEKLEEAKKSGCLVDYRVMACGDDLELLMS
HRTGCDCGDIHGLAWETFEAATETAKGLKLYGYGQDLLADAFSGNIKGMGPGVAEMEITE
RTAEPIIAFMMDKTEPGAFNLPIFKMFADPFNTAGLIIDPSFHHGFTFEVWDILEHKKVL
MNCPEEMYDMLALIGAKSRYVIKRVFAKPGSKIPQSEPVAVISTEKLYQTAGKYVGKDDP
VALVRSQSGLPALGEVLEPFSIGHLVSGWMRGSHNGPLMPCSFDTAHPTRFDGPPRVIAA
GFQLAEGKFVGPVDLFNDLAFDRVRQRCLEITDYMRAHGPFEPHRLPMEEMEYTTLPHVM
DCLRDRFVDTE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagataactataagcttaataaaagccgatgtaggcggctatcccggccactgt
tcggtccatccagaattgatcaagactgcggaggagaagctggaagaggccaaaaagtcc
ggctgtctggtggactacagggttatggcctgcggcgacgatctggagctgctcatgagc
cacaggacgggctgcgactgcggcgacatccacggcctagcctgggagacattcgaggca
gccactgagacggccaagggcctcaagctttatggctatggccaggacctgctggcggac
gccttctccggaaacatcaagggcatgggtccaggggttgcggagatggagataaccgag
cgcacggcagagcccatcatcgcttttatgatggacaagaccgagcccggagccttcaat
ctccccatcttcaagatgtttgccgatccattcaacaccgccgggctgataatagatccc
tccttccatcacggcttcacttttgaggtctgggatatcctagagcacaagaaggtcctc
atgaactgcccggaggagatgtacgatatgctggcgctgatcggtgccaagagccgatat
gtgatcaagagagtctttgccaagcccggcagcaagataccccagagtgagccggtggcg
gtgatcagcactgagaagctctaccagaccgctggcaagtatgtgggcaaggacgatccc
gtggccttagtgaggtcgcagtccggcctgcccgcgctgggcgaggtgctcgagcccttc
tccatcgggcacctggtgagcggatggatgcggggcagccacaacgggccacttatgccc
tgctcatttgataccgctcatcccaccaggttcgacggcccgccacgggtgatagccgcc
ggattccagctagccgaggggaagttcgtggggccggtggatctcttcaatgacctggcc
ttcgaccgcgtccggcagaggtgtctggagatcaccgattacatgagggcgcacggcccc
ttcgagccgcaccggctgcccatggaggaaatggagtataccaccctgcctcatgtaatg
gattgcctgagagatcggttcgtggatacggagtaa

DBGET integrated database retrieval system