KEGG   Methanosaeta concilii: MCON_2641Help
Entry
MCON_2641         CDS       T01468                                 

Definition
(GenBank) cellulase
Organism
mcj  Methanosaeta concilii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2260599..2261651
Genome map
AA seq 350 aa AA seqDB search
MSDIKSLLEKLSNAHGISGWEGSVQKIVREEISPYVDEVRVDKLGNLIATKKGDRPSIMI
DAHADEIGLMVKQIDEKGFIRFIRIGGWFDQTLLNQRVIIHTSSGPVVGVIGSKPPHVMK
DEDRKKVVEARDMFIDIGCSNQAEVEELGILPGTPISIDREFVPMHGDTVTGKAFDNRAG
LVIMIEALKRTKSKSTIYAVAAVQEEVGLKGAKVAAFGLDPDIAIASDVTIPGDHPGIEK
KDAPIEMGKGPVLVVADGSGRGLIATPQVIEWLVGTAKEFEIPVQLEASDGGTTDATSIY
LTRSGIPTGVISVATRYIHSPVEVLNLNDIERAADLMARSLETASRYFKE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcaaatcattgctggaaaagctgagcaacgcccacggcatatccggatgg
gaagggtcggtgcagaagatcgtacgggaagagatctctccttatgtagatgaggtgaga
gtggacaagcttggcaatctcattgccacgaaaaagggagaccgcccatcgattatgatc
gatgcccatgcggacgagatcggtctgatggtaaaacagattgatgagaagggtttcatc
cgcttcattcgcattggcggctggtttgaccagaccctgctaaatcagagagtcatcatc
cataccagctccggcccggtggtgggcgtgatcggctcaaagcctcctcatgttatgaag
gatgaggacagaaagaaggtggtagaggccagagatatgttcatcgatatcggctgctca
aaccaggcagaggtagaggagctgggaatcctgccgggcacgccaatatccatagatcga
gagttcgtaccgatgcatggagacactgtaactggcaaggccttcgacaaccgcgccggc
ctggttattatgatcgaggctcttaagaggaccaaatcaaaatcaaccatctatgcagtg
gccgcagtgcaggaggaggtgggattgaagggagcaaaggtcgccgctttcggcctggac
ccggatatcgccatcgcctcagatgtgaccatacccggagaccatccggggattgagaag
aaggatgcgcccatagagatgggcaaaggcccggtactggtcgtggccgacggctcggga
agagggttgatcgctactccgcaggtgattgagtggctggtggggacggccaaggagttt
gagattccggtgcagctcgaggcctcggacggcgggacgactgatgccacctccatttac
ctaactcgatccgggattcccaccggcgtgatcagcgtcgccacgcgctatatccactcg
ccagtagaggtgctgaatttaaatgatatagaacgggcagcagatcttatggccagaagc
ctggagacggcgtccagatatttcaaagaatga

DBGET integrated database retrieval system